Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4720866..4721468 | Replicon | chromosome |
Accession | NZ_CP100670 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3V4SQH3 |
Locus tag | NL713_RS22860 | Protein ID | WP_001159628.1 |
Coordinates | 4720866..4721177 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL713_RS22865 | Protein ID | WP_000362050.1 |
Coordinates | 4721178..4721468 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL713_RS22825 (4715979) | 4715979..4716578 | + | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
NL713_RS22830 (4716572) | 4716572..4717444 | + | 873 | WP_254520477.1 | virulence factor BrkB family protein | - |
NL713_RS22835 (4717441) | 4717441..4717878 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
NL713_RS22840 (4717923) | 4717923..4718864 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NL713_RS22845 (4718879) | 4718879..4719325 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NL713_RS22850 (4719322) | 4719322..4719633 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
NL713_RS22855 (4719719) | 4719719..4720648 | - | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
NL713_RS22860 (4720866) | 4720866..4721177 | + | 312 | WP_001159628.1 | hypothetical protein | Toxin |
NL713_RS22865 (4721178) | 4721178..4721468 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NL713_RS22870 (4721515) | 4721515..4722444 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NL713_RS22875 (4722441) | 4722441..4723076 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL713_RS22880 (4723073) | 4723073..4723975 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12376.29 Da Isoelectric Point: 9.4460
>T250963 WP_001159628.1 NZ_CP100670:4720866-4721177 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT250963 WP_000362050.1 NZ_CP100670:4721178-4721468 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|