Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4718879..4719633 | Replicon | chromosome |
| Accession | NZ_CP100670 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NL713_RS22850 | Protein ID | WP_000558166.1 |
| Coordinates | 4719322..4719633 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL713_RS22845 | Protein ID | WP_001259011.1 |
| Coordinates | 4718879..4719325 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL713_RS22815 (4714055) | 4714055..4714951 | + | 897 | WP_017441898.1 | sugar kinase | - |
| NL713_RS22820 (4714985) | 4714985..4715788 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NL713_RS22825 (4715979) | 4715979..4716578 | + | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| NL713_RS22830 (4716572) | 4716572..4717444 | + | 873 | WP_254520477.1 | virulence factor BrkB family protein | - |
| NL713_RS22835 (4717441) | 4717441..4717878 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NL713_RS22840 (4717923) | 4717923..4718864 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NL713_RS22845 (4718879) | 4718879..4719325 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NL713_RS22850 (4719322) | 4719322..4719633 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL713_RS22855 (4719719) | 4719719..4720648 | - | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| NL713_RS22860 (4720866) | 4720866..4721177 | + | 312 | WP_001159628.1 | hypothetical protein | - |
| NL713_RS22865 (4721178) | 4721178..4721468 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NL713_RS22870 (4721515) | 4721515..4722444 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NL713_RS22875 (4722441) | 4722441..4723076 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL713_RS22880 (4723073) | 4723073..4723975 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T250962 WP_000558166.1 NZ_CP100670:c4719633-4719322 [Salmonella enterica subsp. enterica serovar Mbandaka]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT250962 WP_001259011.1 NZ_CP100670:c4719325-4718879 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|