Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2492156..2492883 | Replicon | chromosome |
| Accession | NZ_CP100670 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A418Z4H3 |
| Locus tag | NL713_RS11980 | Protein ID | WP_017441960.1 |
| Coordinates | 2492156..2492467 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL713_RS11985 | Protein ID | WP_000561389.1 |
| Coordinates | 2492464..2492883 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL713_RS11950 (2487328) | 2487328..2488050 | - | 723 | WP_017441965.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
| NL713_RS11955 (2488731) | 2488731..2489126 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| NL713_RS11960 (2489454) | 2489454..2489930 | + | 477 | WP_017441964.1 | hypothetical protein | - |
| NL713_RS11965 (2490082) | 2490082..2490234 | + | 153 | WP_153257556.1 | hypothetical protein | - |
| NL713_RS11970 (2490597) | 2490597..2491379 | + | 783 | WP_023242818.1 | DUF2971 domain-containing protein | - |
| NL713_RS11975 (2491678) | 2491678..2491977 | - | 300 | WP_017441961.1 | hypothetical protein | - |
| NL713_RS11980 (2492156) | 2492156..2492467 | + | 312 | WP_017441960.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL713_RS11985 (2492464) | 2492464..2492883 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NL713_RS11990 (2493139) | 2493139..2493633 | + | 495 | WP_077907251.1 | glycosyltransferase | - |
| NL713_RS11995 (2493630) | 2493630..2493788 | + | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
| NL713_RS12000 (2494024) | 2494024..2494443 | - | 420 | WP_017441959.1 | GNAT family N-acetyltransferase | - |
| NL713_RS12005 (2494814) | 2494814..2495083 | + | 270 | WP_077907250.1 | hypothetical protein | - |
| NL713_RS12010 (2495249) | 2495249..2495389 | + | 141 | WP_031615664.1 | hypothetical protein | - |
| NL713_RS12015 (2495535) | 2495535..2496063 | - | 529 | Protein_2346 | transposase | - |
| NL713_RS12020 (2496083) | 2496083..2496175 | - | 93 | WP_230855586.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2495535..2495873 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12453.27 Da Isoelectric Point: 10.1599
>T250953 WP_017441960.1 NZ_CP100670:2492156-2492467 [Salmonella enterica subsp. enterica serovar Mbandaka]
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT250953 WP_000561389.1 NZ_CP100670:2492464-2492883 [Salmonella enterica subsp. enterica serovar Mbandaka]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|