Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4742630..4743384 | Replicon | chromosome |
Accession | NZ_CP100666 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B5RFE2 |
Locus tag | NL709_RS23220 | Protein ID | WP_000558168.1 |
Coordinates | 4743073..4743384 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL709_RS23215 | Protein ID | WP_001259009.1 |
Coordinates | 4742630..4743076 (-) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL709_RS23185 (4737806) | 4737806..4738702 | + | 897 | WP_001520529.1 | sugar kinase | - |
NL709_RS23190 (4738736) | 4738736..4739539 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NL709_RS23195 (4739730) | 4739730..4740329 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
NL709_RS23200 (4740323) | 4740323..4741195 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NL709_RS23205 (4741192) | 4741192..4741629 | + | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
NL709_RS23210 (4741674) | 4741674..4742615 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NL709_RS23215 (4742630) | 4742630..4743076 | - | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
NL709_RS23220 (4743073) | 4743073..4743384 | - | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NL709_RS23225 (4743470) | 4743470..4744399 | - | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
NL709_RS23230 (4744617) | 4744617..4744928 | + | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
NL709_RS23235 (4744929) | 4744929..4745219 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
NL709_RS23240 (4745266) | 4745266..4746195 | - | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
NL709_RS23245 (4746192) | 4746192..4746827 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL709_RS23250 (4746824) | 4746824..4747726 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T250939 WP_000558168.1 NZ_CP100666:c4743384-4743073 [Salmonella enterica subsp. enterica serovar Enteritidis]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT250939 WP_001259009.1 NZ_CP100666:c4743076-4742630 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|