Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2044795..2045020 Replicon chromosome
Accession NZ_CP100666
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag NL709_RS09980 Protein ID WP_000813254.1
Coordinates 2044865..2045020 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2044795..2044853 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL709_RS09940 2039896..2040117 - 222 WP_000560208.1 cell division protein FtsZ -
NL709_RS09945 2040555..2041076 + 522 WP_000004762.1 super-infection exclusion protein B -
NL709_RS09950 2041184..2041339 - 156 WP_085981757.1 DUF1391 family protein -
NL709_RS09955 2041724..2042191 - 468 WP_001227859.1 helix-turn-helix domain-containing protein -
NL709_RS09960 2042373..2042420 + 48 Protein_1934 hypothetical protein -
NL709_RS09965 2042464..2042793 + 330 WP_001676916.1 DUF977 family protein -
NL709_RS09970 2042955..2043509 - 555 WP_001033796.1 hypothetical protein -
NL709_RS09975 2043506..2044438 - 933 WP_254534667.1 hypothetical protein -
- 2044795..2044853 - 59 - - Antitoxin
NL709_RS09980 2044865..2045020 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
NL709_RS09985 2045311..2045481 + 171 WP_000734094.1 hypothetical protein -
NL709_RS09990 2045544..2046143 + 600 WP_000940751.1 DUF1367 family protein -
NL709_RS09995 2046143..2046433 + 291 WP_000774470.1 DUF1364 domain-containing protein -
NL709_RS10000 2046430..2046966 + 537 WP_000640113.1 DUF1133 family protein -
NL709_RS10005 2049137..2049460 + 324 Protein_1943 tellurite/colicin resistance protein -
NL709_RS10010 2049454..2049642 + 189 WP_001688615.1 putative holin -
NL709_RS10015 2049632..2049913 + 282 WP_000445513.1 phage holin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2038584..2050455 11871


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T250931 WP_000813254.1 NZ_CP100666:2044865-2045020 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT250931 NZ_CP100666:c2044853-2044795 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References