Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 4841838..4842442 | Replicon | chromosome |
Accession | NZ_CP100660 | ||
Organism | Pseudomonas fluorescens strain ZL22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NLL86_RS22245 | Protein ID | WP_254481237.1 |
Coordinates | 4841838..4842158 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NLL86_RS22250 | Protein ID | WP_254481238.1 |
Coordinates | 4842155..4842442 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLL86_RS22220 (NLL86_22220) | 4837402..4837632 | + | 231 | WP_254481233.1 | cysteine-rich CWC family protein | - |
NLL86_RS22225 (NLL86_22225) | 4837676..4838377 | + | 702 | WP_254481234.1 | pseudouridine synthase | - |
NLL86_RS22230 (NLL86_22230) | 4838701..4839600 | + | 900 | WP_254481235.1 | alpha/beta hydrolase | - |
NLL86_RS22240 (NLL86_22240) | 4839985..4841685 | + | 1701 | WP_254481236.1 | SulP family inorganic anion transporter | - |
NLL86_RS22245 (NLL86_22245) | 4841838..4842158 | + | 321 | WP_254481237.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLL86_RS22250 (NLL86_22250) | 4842155..4842442 | + | 288 | WP_254481238.1 | NadS family protein | Antitoxin |
NLL86_RS22255 (NLL86_22255) | 4842589..4843599 | + | 1011 | WP_254481239.1 | DUF4917 family protein | - |
NLL86_RS22260 (NLL86_22260) | 4843616..4844830 | - | 1215 | WP_254481240.1 | SAM-dependent methyltransferase | - |
NLL86_RS22265 (NLL86_22265) | 4844904..4845521 | - | 618 | WP_254481241.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12028.97 Da Isoelectric Point: 10.2237
>T250918 WP_254481237.1 NZ_CP100660:4841838-4842158 [Pseudomonas fluorescens]
MLFIETPIFTKRVKELLEDGIYRLLQVKLMSAPDAGDLIEGTGGLRKLRVAASGHGKRGGARVIYYHFTSSSQIAMLYIF
PKNEQSDLSAEQRKALKNIIEHWRHT
MLFIETPIFTKRVKELLEDGIYRLLQVKLMSAPDAGDLIEGTGGLRKLRVAASGHGKRGGARVIYYHFTSSSQIAMLYIF
PKNEQSDLSAEQRKALKNIIEHWRHT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|