Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1070957..1071620 | Replicon | chromosome |
| Accession | NZ_CP100660 | ||
| Organism | Pseudomonas fluorescens strain ZL22 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NLL86_RS04770 | Protein ID | WP_254483337.1 |
| Coordinates | 1070957..1071286 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NLL86_RS04775 | Protein ID | WP_254485526.1 |
| Coordinates | 1071291..1071620 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLL86_RS04750 (NLL86_04750) | 1067095..1068252 | - | 1158 | WP_254483335.1 | ABC transporter ATP-binding protein | - |
| NLL86_RS04755 (NLL86_04755) | 1068249..1068902 | - | 654 | WP_054901077.1 | ABC transporter permease | - |
| NLL86_RS04760 (NLL86_04760) | 1068899..1069813 | - | 915 | WP_254483336.1 | glycine betaine ABC transporter substrate-binding protein | - |
| NLL86_RS04765 (NLL86_04765) | 1069827..1070540 | - | 714 | WP_054887588.1 | ABC transporter permease | - |
| NLL86_RS04770 (NLL86_04770) | 1070957..1071286 | + | 330 | WP_254483337.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLL86_RS04775 (NLL86_04775) | 1071291..1071620 | + | 330 | WP_254485526.1 | XRE family transcriptional regulator | Antitoxin |
| NLL86_RS04780 (NLL86_04780) | 1071714..1073297 | + | 1584 | WP_254483339.1 | peptide chain release factor 3 | - |
| NLL86_RS04785 (NLL86_04785) | 1073330..1074409 | - | 1080 | WP_254483341.1 | polyamine ABC transporter substrate-binding protein | - |
| NLL86_RS04790 (NLL86_04790) | 1074461..1074802 | - | 342 | WP_254483342.1 | cupin domain-containing protein | - |
| NLL86_RS04795 (NLL86_04795) | 1074835..1076241 | - | 1407 | WP_254483343.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12421.25 Da Isoelectric Point: 7.8842
>T250914 WP_254483337.1 NZ_CP100660:1070957-1071286 [Pseudomonas fluorescens]
MCSEFVVEFSELEEVVQDELLAQLHLLKCIGPALGRPHVDTLKGSMYSNMKELRFNAAGGVWRVAFAFDRYRSALLLAAG
NKAGISERRFYRSLIDRADERFDRHLSRG
MCSEFVVEFSELEEVVQDELLAQLHLLKCIGPALGRPHVDTLKGSMYSNMKELRFNAAGGVWRVAFAFDRYRSALLLAAG
NKAGISERRFYRSLIDRADERFDRHLSRG
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|