Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5410175..5410770 | Replicon | chromosome |
| Accession | NZ_CP100653 | ||
| Organism | Pseudomonas aeruginosa strain F13 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | NLS69_RS25335 | Protein ID | WP_003113526.1 |
| Coordinates | 5410492..5410770 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NLS69_RS25330 | Protein ID | WP_003099268.1 |
| Coordinates | 5410175..5410480 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLS69_RS25295 (NLS69_25295) | 5405314..5406162 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| NLS69_RS25305 (NLS69_25305) | 5406329..5407270 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| NLS69_RS25310 (NLS69_25310) | 5407387..5408001 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| NLS69_RS25315 (NLS69_25315) | 5408043..5408627 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| NLS69_RS25320 (NLS69_25320) | 5408668..5409768 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| NLS69_RS25330 (NLS69_25330) | 5410175..5410480 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| NLS69_RS25335 (NLS69_25335) | 5410492..5410770 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLS69_RS25340 (NLS69_25340) | 5410823..5410951 | - | 129 | Protein_5005 | integrase | - |
| NLS69_RS25345 (NLS69_25345) | 5411099..5413327 | + | 2229 | WP_025271371.1 | TonB-dependent receptor | - |
| NLS69_RS25350 (NLS69_25350) | 5413397..5414044 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| NLS69_RS25355 (NLS69_25355) | 5414106..5415344 | - | 1239 | WP_025271372.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T250913 WP_003113526.1 NZ_CP100653:c5410770-5410492 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|