Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4784483..4785164 | Replicon | chromosome |
Accession | NZ_CP100653 | ||
Organism | Pseudomonas aeruginosa strain F13 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NLS69_RS22455 | Protein ID | WP_015503432.1 |
Coordinates | 4784799..4785164 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NLS69_RS22450 | Protein ID | WP_016561576.1 |
Coordinates | 4784483..4784806 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLS69_RS22415 (NLS69_22415) | 4780375..4781058 | - | 684 | WP_003120766.1 | TetR/AcrR family transcriptional regulator | - |
NLS69_RS22420 (NLS69_22420) | 4781146..4782024 | + | 879 | WP_003163191.1 | hypothetical protein | - |
NLS69_RS22430 (NLS69_22430) | 4782627..4782854 | + | 228 | WP_014603215.1 | hypothetical protein | - |
NLS69_RS22435 (NLS69_22435) | 4782869..4783861 | - | 993 | Protein_4438 | tyrosine-type recombinase/integrase | - |
NLS69_RS22440 (NLS69_22440) | 4783861..4784253 | - | 393 | Protein_4439 | hypothetical protein | - |
NLS69_RS22445 (NLS69_22445) | 4784248..4784367 | + | 120 | Protein_4440 | IS5/IS1182 family transposase | - |
NLS69_RS22450 (NLS69_22450) | 4784483..4784806 | - | 324 | WP_016561576.1 | XRE family transcriptional regulator | Antitoxin |
NLS69_RS22455 (NLS69_22455) | 4784799..4785164 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLS69_RS22460 (NLS69_22460) | 4785428..4785670 | - | 243 | WP_043884955.1 | hypothetical protein | - |
NLS69_RS22465 (NLS69_22465) | 4785877..4786149 | + | 273 | WP_003085667.1 | hypothetical protein | - |
NLS69_RS22470 (NLS69_22470) | 4786168..4786593 | - | 426 | WP_003114206.1 | VOC family protein | - |
NLS69_RS22475 (NLS69_22475) | 4786694..4787578 | + | 885 | WP_016253805.1 | LysR substrate-binding domain-containing protein | - |
NLS69_RS22480 (NLS69_22480) | 4787551..4788504 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
NLS69_RS22485 (NLS69_22485) | 4788725..4789159 | + | 435 | WP_016253806.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T250912 WP_015503432.1 NZ_CP100653:c4785164-4784799 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|