Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1207771..1208393 | Replicon | chromosome |
| Accession | NZ_CP100653 | ||
| Organism | Pseudomonas aeruginosa strain F13 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NLS69_RS05685 | Protein ID | WP_033967229.1 |
| Coordinates | 1207771..1208085 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NLS69_RS05690 | Protein ID | WP_023910258.1 |
| Coordinates | 1208088..1208393 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLS69_RS05655 (NLS69_05655) | 1202861..1203049 | + | 189 | WP_003118306.1 | Com family DNA-binding transcriptional regulator | - |
| NLS69_RS05660 (NLS69_05660) | 1203054..1203416 | + | 363 | WP_023105983.1 | hypothetical protein | - |
| NLS69_RS05665 (NLS69_05665) | 1203878..1204834 | + | 957 | WP_225036329.1 | site-specific integrase | - |
| NLS69_RS05670 (NLS69_05670) | 1204903..1205214 | + | 312 | WP_225036327.1 | outer membrane protein assembly factor BamE | - |
| NLS69_RS05675 (NLS69_05675) | 1205355..1206005 | + | 651 | WP_225036326.1 | BRCT domain-containing protein | - |
| NLS69_RS05680 (NLS69_05680) | 1206210..1207382 | + | 1173 | WP_209408793.1 | ATP-binding protein | - |
| NLS69_RS05685 (NLS69_05685) | 1207771..1208085 | + | 315 | WP_033967229.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLS69_RS05690 (NLS69_05690) | 1208088..1208393 | + | 306 | WP_023910258.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NLS69_RS05695 (NLS69_05695) | 1208454..1208753 | - | 300 | WP_225036325.1 | hypothetical protein | - |
| NLS69_RS05700 (NLS69_05700) | 1208854..1209066 | - | 213 | WP_225036324.1 | hypothetical protein | - |
| NLS69_RS05705 (NLS69_05705) | 1209063..1210943 | - | 1881 | WP_225036323.1 | DNA cytosine methyltransferase | - |
| NLS69_RS05710 (NLS69_05710) | 1210940..1211419 | - | 480 | WP_225036322.1 | hypothetical protein | - |
| NLS69_RS05715 (NLS69_05715) | 1211429..1211668 | - | 240 | WP_015649068.1 | hypothetical protein | - |
| NLS69_RS05720 (NLS69_05720) | 1211665..1212291 | - | 627 | WP_225036319.1 | hypothetical protein | - |
| NLS69_RS05725 (NLS69_05725) | 1212342..1212659 | - | 318 | WP_225036318.1 | pyocin activator PrtN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1203878..1244134 | 40256 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11772.54 Da Isoelectric Point: 9.4385
>T250906 WP_033967229.1 NZ_CP100653:1207771-1208085 [Pseudomonas aeruginosa]
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLVY
DKASQEDLTADQKKVLRQIVENWR
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLVY
DKASQEDLTADQKKVLRQIVENWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|