Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5272709..5273310 | Replicon | chromosome |
Accession | NZ_CP100652 | ||
Organism | Pseudomonas putida strain HSM-C2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A379KEL1 |
Locus tag | NL778_RS24075 | Protein ID | WP_046788307.1 |
Coordinates | 5272996..5273310 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL778_RS24070 | Protein ID | WP_046788286.1 |
Coordinates | 5272709..5272996 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL778_RS24060 (NL778_24060) | 5269546..5270463 | + | 918 | WP_254466764.1 | sce7725 family protein | - |
NL778_RS24065 (NL778_24065) | 5270483..5272237 | + | 1755 | WP_204919154.1 | anti-phage dCTP deaminase | - |
NL778_RS24070 (NL778_24070) | 5272709..5272996 | - | 288 | WP_046788286.1 | helix-turn-helix domain-containing protein | Antitoxin |
NL778_RS24075 (NL778_24075) | 5272996..5273310 | - | 315 | WP_046788307.1 | hypothetical protein | Toxin |
NL778_RS24080 (NL778_24080) | 5273529..5274176 | + | 648 | WP_254466766.1 | hypothetical protein | - |
NL778_RS24085 (NL778_24085) | 5274577..5276238 | + | 1662 | WP_254466767.1 | FMN-binding glutamate synthase family protein | - |
NL778_RS24090 (NL778_24090) | 5276356..5277675 | - | 1320 | WP_012316697.1 | OprD family porin | - |
NL778_RS24095 (NL778_24095) | 5278105..5278302 | - | 198 | WP_012316698.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11831.73 Da Isoelectric Point: 10.1456
>T250904 WP_046788307.1 NZ_CP100652:c5273310-5272996 [Pseudomonas putida]
MIFIETPIFTQDVKEHLGDDEYRELQSYLAGQPIAGDLIEGTGGLRKIRWSAKGKGKSGGVRVIYYHVSSAYQIRMILIY
RKGIMDTLTDKQKAQLRAINKGWK
MIFIETPIFTQDVKEHLGDDEYRELQSYLAGQPIAGDLIEGTGGLRKIRWSAKGKGKSGGVRVIYYHVSSAYQIRMILIY
RKGIMDTLTDKQKAQLRAINKGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|