Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3808511..3809211 | Replicon | chromosome |
| Accession | NZ_CP100652 | ||
| Organism | Pseudomonas putida strain HSM-C2 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | NL778_RS17355 | Protein ID | WP_254466165.1 |
| Coordinates | 3808915..3809211 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | NL778_RS17350 | Protein ID | WP_254466164.1 |
| Coordinates | 3808511..3808912 (-) | Length | 134 a.a. |
Genomic Context
Location: 3806778..3808442 (1665 bp)
Type: Others
Protein ID: WP_012315361.1
Type: Others
Protein ID: WP_012315361.1
Location: 3812030..3813208 (1179 bp)
Type: Others
Protein ID: WP_254467901.1
Type: Others
Protein ID: WP_254467901.1
Location: 3803643..3804464 (822 bp)
Type: Others
Protein ID: WP_042111599.1
Type: Others
Protein ID: WP_042111599.1
Location: 3804542..3805471 (930 bp)
Type: Others
Protein ID: WP_012315359.1
Type: Others
Protein ID: WP_012315359.1
Location: 3805472..3806221 (750 bp)
Type: Others
Protein ID: WP_012315360.1
Type: Others
Protein ID: WP_012315360.1
Location: 3808511..3808912 (402 bp)
Type: Antitoxin
Protein ID: WP_254466164.1
Type: Antitoxin
Protein ID: WP_254466164.1
Location: 3808915..3809211 (297 bp)
Type: Toxin
Protein ID: WP_254466165.1
Type: Toxin
Protein ID: WP_254466165.1
Location: 3809306..3810631 (1326 bp)
Type: Others
Protein ID: WP_254466166.1
Type: Others
Protein ID: WP_254466166.1
Location: 3810698..3811177 (480 bp)
Type: Others
Protein ID: WP_012315365.1
Type: Others
Protein ID: WP_012315365.1
Location: 3811349..3811825 (477 bp)
Type: Others
Protein ID: WP_012315366.1
Type: Others
Protein ID: WP_012315366.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL778_RS17330 (NL778_17330) | 3803643..3804464 | - | 822 | WP_042111599.1 | transporter substrate-binding domain-containing protein | - |
| NL778_RS17335 (NL778_17335) | 3804542..3805471 | - | 930 | WP_012315359.1 | FAD-binding protein | - |
| NL778_RS17340 (NL778_17340) | 3805472..3806221 | - | 750 | WP_012315360.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
| NL778_RS17345 (NL778_17345) | 3806778..3808442 | + | 1665 | WP_012315361.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
| NL778_RS17350 (NL778_17350) | 3808511..3808912 | - | 402 | WP_254466164.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| NL778_RS17355 (NL778_17355) | 3808915..3809211 | - | 297 | WP_254466165.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| NL778_RS17360 (NL778_17360) | 3809306..3810631 | - | 1326 | WP_254466166.1 | MFS transporter | - |
| NL778_RS17365 (NL778_17365) | 3810698..3811177 | - | 480 | WP_012315365.1 | response regulator | - |
| NL778_RS17370 (NL778_17370) | 3811349..3811825 | - | 477 | WP_012315366.1 | sigma-70 family RNA polymerase sigma factor | - |
| NL778_RS17375 (NL778_17375) | 3812030..3813208 | + | 1179 | WP_254467901.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11177.95 Da Isoelectric Point: 8.4782
>T250902 WP_254466165.1 NZ_CP100652:c3809211-3808915 [Pseudomonas putida]
MEKRTPHCSLERIRALVSAGRISPTTASLRGAQALGMDYPDMLEIINGLERRDFQKSMTCHGDYRVWQDVYRPLTGKGYV
YLKLSVVDDVLIVSFKEL
MEKRTPHCSLERIRALVSAGRISPTTASLRGAQALGMDYPDMLEIINGLERRDFQKSMTCHGDYRVWQDVYRPLTGKGYV
YLKLSVVDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14607.74 Da Isoelectric Point: 6.4547
>AT250902 WP_254466164.1 NZ_CP100652:c3808912-3808511 [Pseudomonas putida]
MKCPVCGGAELAPDTRDMPYRYKGEVTVIPNVSGGYCTACGEAVLSHDEAMRISPLMSAFNRQVNAAAVDPDFIVAVRKK
FDLDQREAGEIFGGGVNAFSRYENGKTRPPVALVKLFKLLDRHPELFEEVRTA
MKCPVCGGAELAPDTRDMPYRYKGEVTVIPNVSGGYCTACGEAVLSHDEAMRISPLMSAFNRQVNAAAVDPDFIVAVRKK
FDLDQREAGEIFGGGVNAFSRYENGKTRPPVALVKLFKLLDRHPELFEEVRTA
Download Length: 402 bp