Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2269810..2270139 | Replicon | chromosome |
Accession | NZ_CP100651 | ||
Organism | Bacillus halotolerans strain MEC_B334 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | NLW79_RS11555 | Protein ID | WP_213417645.1 |
Coordinates | 2269810..2270061 (-) | Length | 84 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2270039..2270139 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLW79_RS11540 | 2266053..2267924 | - | 1872 | WP_254517597.1 | hypothetical protein | - |
NLW79_RS11545 | 2268263..2269495 | - | 1233 | WP_254517598.1 | hypothetical protein | - |
NLW79_RS11550 | 2269577..2269765 | - | 189 | WP_254517599.1 | hypothetical protein | - |
NLW79_RS11555 | 2269810..2270061 | - | 252 | WP_213417645.1 | hypothetical protein | Toxin |
- | 2270039..2270139 | + | 101 | - | - | Antitoxin |
NLW79_RS11560 | 2270080..2270256 | - | 177 | WP_254517601.1 | hypothetical protein | - |
- | 2270197..2270296 | + | 100 | NuclAT_0 | - | - |
- | 2270197..2270296 | + | 100 | NuclAT_0 | - | - |
- | 2270197..2270296 | + | 100 | NuclAT_0 | - | - |
- | 2270197..2270296 | + | 100 | NuclAT_0 | - | - |
NLW79_RS11565 | 2270490..2270711 | - | 222 | WP_106019959.1 | hypothetical protein | - |
NLW79_RS11570 | 2270792..2271397 | - | 606 | WP_106019960.1 | hypothetical protein | - |
NLW79_RS11575 | 2271617..2271943 | - | 327 | WP_106019961.1 | helix-turn-helix transcriptional regulator | - |
NLW79_RS11580 | 2272895..2273089 | + | 195 | WP_072692657.1 | hypothetical protein | - |
NLW79_RS11585 | 2273129..2275003 | + | 1875 | Protein_2230 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2198086..2368636 | 170550 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 10149.20 Da Isoelectric Point: 10.0301
>T250893 WP_213417645.1 NZ_CP100651:c2270061-2269810 [Bacillus halotolerans]
MNFSFSSYPYYNMIKHIVNMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINTIFVVTCIIIFLIWIIYFVFLKLRN
KSH
MNFSFSSYPYYNMIKHIVNMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINTIFVVTCIIIFLIWIIYFVFLKLRN
KSH
Download Length: 252 bp
Antitoxin
Download Length: 101 bp
>AT250893 NZ_CP100651:2270039-2270139 [Bacillus halotolerans]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|