Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3831015..3831612 | Replicon | chromosome |
| Accession | NZ_CP100601 | ||
| Organism | Klebsiella pneumoniae strain WX17388 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | NLI98_RS18555 | Protein ID | WP_004142563.1 |
| Coordinates | 3831295..3831612 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | NLI98_RS18550 | Protein ID | WP_004142561.1 |
| Coordinates | 3831015..3831302 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLI98_RS18520 (3827096) | 3827096..3827344 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| NLI98_RS18525 (3827362) | 3827362..3827703 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| NLI98_RS18530 (3827734) | 3827734..3828849 | - | 1116 | WP_172676897.1 | MBL fold metallo-hydrolase | - |
| NLI98_RS18535 (3829028) | 3829028..3829609 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| NLI98_RS18540 (3829609) | 3829609..3829977 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| NLI98_RS18545 (3830097) | 3830097..3830750 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| NLI98_RS18550 (3831015) | 3831015..3831302 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NLI98_RS18555 (3831295) | 3831295..3831612 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLI98_RS18560 (3831797) | 3831797..3832840 | - | 1044 | WP_088498345.1 | DUF2157 domain-containing protein | - |
| NLI98_RS18565 (3833510) | 3833510..3834376 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| NLI98_RS18570 (3834485) | 3834485..3835912 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T250881 WP_004142563.1 NZ_CP100601:c3831612-3831295 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |