Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2654113..2654557 | Replicon | chromosome |
| Accession | NZ_CP100596 | ||
| Organism | Enterococcus faecalis strain Chr-JH 2-2 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | NLG43_RS12990 | Protein ID | WP_002392696.1 |
| Coordinates | 2654414..2654557 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2654113..2654248 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG43_RS12975 | 2649660..2650373 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| NLG43_RS12980 | 2650635..2653379 | + | 2745 | WP_002406717.1 | glycosyl hydrolase family 65 protein | - |
| NLG43_RS12985 | 2653394..2654044 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - | 2654113..2654248 | + | 136 | - | - | Antitoxin |
| NLG43_RS12990 | 2654414..2654557 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| NLG43_RS12995 | 2654789..2654932 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
| NLG43_RS13000 | 2655163..2656134 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| NLG43_RS13005 | 2656309..2656743 | - | 435 | WP_033918108.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| NLG43_RS13010 | 2656876..2657430 | - | 555 | WP_002396824.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T250861 WP_002392696.1 NZ_CP100596:c2654557-2654414 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 136 bp
>AT250861 NZ_CP100596:2654113-2654248 [Enterococcus faecalis]
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCTTTTGGATTAATTAAAAATA
ACCGTACTTGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCTTTTGGATTAATTAAAAATA
ACCGTACTTGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|