Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3100600..3101249 | Replicon | chromosome |
| Accession | NZ_CP100553 | ||
| Organism | Pseudomonas hydrolytica strain KHPS2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NLY38_RS14430 | Protein ID | WP_254347854.1 |
| Coordinates | 3100600..3100944 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1H0F3K8 |
| Locus tag | NLY38_RS14435 | Protein ID | WP_074879837.1 |
| Coordinates | 3100941..3101249 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY38_RS14415 (NLY38_14415) | 3096363..3098216 | + | 1854 | WP_254347851.1 | asparagine synthase (glutamine-hydrolyzing) | - |
| NLY38_RS14420 (NLY38_14420) | 3098303..3099502 | + | 1200 | WP_254347852.1 | MFS transporter | - |
| NLY38_RS14425 (NLY38_14425) | 3099516..3100442 | + | 927 | WP_254347853.1 | LysR family transcriptional regulator | - |
| NLY38_RS14430 (NLY38_14430) | 3100600..3100944 | + | 345 | WP_254347854.1 | toxin | Toxin |
| NLY38_RS14435 (NLY38_14435) | 3100941..3101249 | + | 309 | WP_074879837.1 | transcriptional regulator | Antitoxin |
| NLY38_RS14440 (NLY38_14440) | 3101608..3102120 | + | 513 | WP_254347855.1 | hypothetical protein | - |
| NLY38_RS14445 (NLY38_14445) | 3102117..3102491 | + | 375 | WP_254347856.1 | hypothetical protein | - |
| NLY38_RS14450 (NLY38_14450) | 3102481..3103176 | + | 696 | WP_254347858.1 | hypothetical protein | - |
| NLY38_RS14455 (NLY38_14455) | 3103238..3103627 | + | 390 | WP_254347860.1 | hypothetical protein | - |
| NLY38_RS14460 (NLY38_14460) | 3103726..3105345 | + | 1620 | WP_254347862.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3058117..3123193 | 65076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13320.12 Da Isoelectric Point: 9.8734
>T250853 WP_254347854.1 NZ_CP100553:3100600-3100944 [Pseudomonas hydrolytica]
MKASFVELSPFERNRNAYLDDDEYSLFQQMLLANPEAGPVITNSGGLRKIRFGSVRRSKGKRGGVRVIYYYWHSGLQFWL
FTLYDKDELDDLSSDQRRQLKALLEREVKARQAP
MKASFVELSPFERNRNAYLDDDEYSLFQQMLLANPEAGPVITNSGGLRKIRFGSVRRSKGKRGGVRVIYYYWHSGLQFWL
FTLYDKDELDDLSSDQRRQLKALLEREVKARQAP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|