Detailed information of TA system TA250841

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 106151..106577
• Replicon: plasmid pLH09-a-A
• Accession: NZ_CP100545
• Organism: Escherichia coli strain LH09-a

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NLZ06_RS22890
• Protein ID: WP_001372321.1
• Coordinates: 106151..106276 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	106353..106577 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NLZ06_RS22855 (101725)	101725..102327	+	603	WP_254521281.1	transglycosylase SLT domain-containing protein	-
NLZ06_RS22860 (102624)	102624..103445	-	822	WP_001234469.1	DUF932 domain-containing protein	-
NLZ06_RS22865 (103564)	103564..103851	-	288	WP_000107548.1	hypothetical protein	-
NLZ06_RS22870 (104102)	104102..105106	+	1005	WP_024257664.1	IS110 family transposase	-
NLZ06_RS22875 (105200)	105200..105460	-	261	WP_254521282.1	single-stranded DNA-binding protein	-
NLZ06_RS22880 (105530)	105530..105703	+	174	Protein_107	hypothetical protein	-
NLZ06_RS22885 (105701)	105701..105931	-	231	WP_001426396.1	hypothetical protein	-
NLZ06_RS22890 (106151)	106151..106276	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NLZ06_RS22895 (106218)	106218..106367	-	150	Protein_110	plasmid maintenance protein Mok	-
- (106355)	106355..106420	-	66	NuclAT_1	-	-
- (106353)	106353..106577	+	225	NuclAT_0	-	-
- (106353)	106353..106577	-	225	NuclAT_0	-	Antitoxin
- (106353)	106353..106577	-	225	NuclAT_0	-	Antitoxin
- (106353)	106353..106577	-	225	NuclAT_0	-	Antitoxin
- (106353)	106353..106577	-	225	NuclAT_0	-	Antitoxin
NLZ06_RS22900 (106389)	106389..106577	+	189	WP_001299721.1	hypothetical protein	-
NLZ06_RS22905 (106546)	106546..107308	-	763	Protein_112	plasmid SOS inhibition protein A	-
NLZ06_RS22910 (107305)	107305..107739	-	435	WP_137433372.1	conjugation system SOS inhibitor PsiB	-
NLZ06_RS22915 (107794)	107794..109752	-	1959	WP_112025190.1	ParB/RepB/Spo0J family partition protein	-
NLZ06_RS22920 (109811)	109811..110044	-	234	WP_000006004.1	DUF905 domain-containing protein	-
NLZ06_RS22925 (110100)	110100..110627	-	528	WP_000290793.1	single-stranded DNA-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iroB / iroC / iroD / iroE / iroN	1..135017	135017

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T250841 WP_001372321.1 NZ_CP100545:c106276-106151 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT250841 NZ_CP100545:c106577-106353 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin