Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4475084..4475686 | Replicon | chromosome |
Accession | NZ_CP100544 | ||
Organism | Escherichia coli strain LH09-a |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NLZ06_RS21360 | Protein ID | WP_000897305.1 |
Coordinates | 4475375..4475686 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NLZ06_RS21355 | Protein ID | WP_000356397.1 |
Coordinates | 4475084..4475374 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ06_RS21330 (4470631) | 4470631..4471266 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NLZ06_RS21335 (4471263) | 4471263..4472192 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NLZ06_RS21340 (4472591) | 4472591..4473571 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
NLZ06_RS21345 (4473800) | 4473800..4474042 | - | 243 | WP_001086388.1 | protein YiiF | - |
NLZ06_RS21350 (4474261) | 4474261..4474479 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NLZ06_RS21355 (4475084) | 4475084..4475374 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NLZ06_RS21360 (4475375) | 4475375..4475686 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NLZ06_RS21365 (4475915) | 4475915..4476823 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NLZ06_RS21370 (4476887) | 4476887..4477828 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NLZ06_RS21375 (4477873) | 4477873..4478310 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NLZ06_RS21380 (4478307) | 4478307..4479179 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NLZ06_RS21385 (4479173) | 4479173..4479772 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
NLZ06_RS21390 (4479871) | 4479871..4480656 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4472591..4473571 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T250839 WP_000897305.1 NZ_CP100544:c4475686-4475375 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|