Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328781..329367 Replicon chromosome
Accession NZ_CP100542
Organism Klebsiella pneumoniae strain LH09-d

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NLZ07_RS01535 Protein ID WP_023285605.1
Coordinates 328999..329367 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NLZ07_RS01530 Protein ID WP_004174006.1
Coordinates 328781..329002 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ07_RS01510 (324938) 324938..325864 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NLZ07_RS01515 (325861) 325861..327138 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NLZ07_RS01520 (327135) 327135..327902 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NLZ07_RS01525 (327904) 327904..328617 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NLZ07_RS01530 (328781) 328781..329002 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NLZ07_RS01535 (328999) 328999..329367 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NLZ07_RS01540 (329640) 329640..330956 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NLZ07_RS01545 (331063) 331063..331950 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NLZ07_RS01550 (331947) 331947..332792 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NLZ07_RS01555 (332794) 332794..333864 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325861..334601 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T250809 WP_023285605.1 NZ_CP100542:328999-329367 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT250809 WP_004174006.1 NZ_CP100542:328781-329002 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References