Detailed information of TA system TA250806

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 40128..40554
• Replicon: plasmid pLH10-b-1-C
• Accession: NZ_CP100533
• Organism: Escherichia coli strain LH10-b-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NLZ08_RS25945
• Protein ID: WP_001372321.1
• Coordinates: 40128..40253 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	40330..40554 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NLZ08_RS25900 (35175)	35175..35402	-	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-
NLZ08_RS25905 (35496)	35496..36182	-	687	WP_000332493.1	PAS domain-containing protein	-
NLZ08_RS25910 (36373)	36373..36756	-	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NLZ08_RS25915 (37033)	37033..37680	+	648	WP_000615259.1	transglycosylase SLT domain-containing protein	-
NLZ08_RS25920 (37977)	37977..38798	-	822	WP_001234469.1	DUF932 domain-containing protein	-
NLZ08_RS25925 (38920)	38920..39207	-	288	WP_000107535.1	hypothetical protein	-
NLZ08_RS25930 (39232)	39232..39438	-	207	WP_000547971.1	hypothetical protein	-
NLZ08_RS25935 (39508)	39508..39681	+	174	Protein_54	hypothetical protein	-
NLZ08_RS25940 (39679)	39679..39909	-	231	WP_001426396.1	hypothetical protein	-
NLZ08_RS25945 (40128)	40128..40253	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NLZ08_RS25950 (40195)	40195..40344	-	150	Protein_57	plasmid maintenance protein Mok	-
- (40332)	40332..40397	-	66	NuclAT_1	-	-
- (40330)	40330..40554	+	225	NuclAT_0	-	-
- (40330)	40330..40554	-	225	NuclAT_0	-	Antitoxin
- (40330)	40330..40554	-	225	NuclAT_0	-	Antitoxin
- (40330)	40330..40554	-	225	NuclAT_0	-	Antitoxin
- (40330)	40330..40554	-	225	NuclAT_0	-	Antitoxin
NLZ08_RS25955 (40366)	40366..40554	+	189	WP_001299721.1	hypothetical protein	-
NLZ08_RS25960 (40523)	40523..41285	-	763	Protein_59	plasmid SOS inhibition protein A	-
NLZ08_RS25965 (41282)	41282..41716	-	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
NLZ08_RS25970 (41771)	41771..43729	-	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
NLZ08_RS25975 (43794)	43794..44027	-	234	WP_000006030.1	DUF905 family protein	-
NLZ08_RS25980 (44089)	44089..44628	-	540	WP_000290812.1	single-stranded DNA-binding protein	-
NLZ08_RS25985 (44826)	44826..45053	-	228	WP_071594011.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sitABCD	-	1..67280	67280

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T250806 WP_001372321.1 NZ_CP100533:c40253-40128 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT250806 NZ_CP100533:c40554-40330 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin