Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
Location | 4171572..4171984 | Replicon | chromosome |
Accession | NZ_CP100530 | ||
Organism | Escherichia coli strain LH10-b-1 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | NLZ08_RS20575 | Protein ID | WP_097749251.1 |
Coordinates | 4171643..4171984 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4171572..4171648 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ08_RS20565 (4168522) | 4168522..4170111 | + | 1590 | WP_097749252.1 | type I restriction-modification system methyltransferase | - |
NLZ08_RS20570 (4170108) | 4170108..4171415 | + | 1308 | WP_201796878.1 | restriction endonuclease subunit S | - |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4171572) | 4171572..4171648 | - | 77 | NuclAT_16 | - | Antitoxin |
NLZ08_RS20575 (4171643) | 4171643..4171984 | + | 342 | WP_097749251.1 | endoribonuclease SymE | Toxin |
NLZ08_RS20580 (4172146) | 4172146..4172910 | + | 765 | Protein_4034 | DUF3578 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12321.20 Da Isoelectric Point: 8.5012
>T250795 WP_097749251.1 NZ_CP100530:4171643-4171984 [Escherichia coli]
MTDTHFIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVAVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKHKVA
MTDTHFIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVAVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKHKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT250795 NZ_CP100530:c4171648-4171572 [Escherichia coli]
AGTCATAACTGCTATTCTCCTGGAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCTGGAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|