Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3847132..3847826 | Replicon | chromosome |
| Accession | NZ_CP100530 | ||
| Organism | Escherichia coli strain LH10-b-1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | NLZ08_RS19070 | Protein ID | WP_001263493.1 |
| Coordinates | 3847132..3847530 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | NLZ08_RS19075 | Protein ID | WP_000554757.1 |
| Coordinates | 3847533..3847826 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3842792) | 3842792..3842872 | - | 81 | NuclAT_13 | - | - |
| - (3842792) | 3842792..3842872 | - | 81 | NuclAT_13 | - | - |
| - (3842792) | 3842792..3842872 | - | 81 | NuclAT_13 | - | - |
| - (3842792) | 3842792..3842872 | - | 81 | NuclAT_13 | - | - |
| NLZ08_RS19040 (3842132) | 3842132..3843376 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NLZ08_RS19045 (3843468) | 3843468..3843926 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NLZ08_RS19050 (3844187) | 3844187..3845644 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| NLZ08_RS19055 (3845701) | 3845701..3846222 | - | 522 | Protein_3737 | peptide chain release factor H | - |
| NLZ08_RS19060 (3846221) | 3846221..3846424 | - | 204 | Protein_3738 | RtcB family protein | - |
| NLZ08_RS19065 (3846670) | 3846670..3847122 | - | 453 | WP_097749298.1 | GNAT family N-acetyltransferase | - |
| NLZ08_RS19070 (3847132) | 3847132..3847530 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NLZ08_RS19075 (3847533) | 3847533..3847826 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NLZ08_RS19080 (3847878) | 3847878..3848933 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NLZ08_RS19085 (3849004) | 3849004..3849789 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| NLZ08_RS19090 (3849761) | 3849761..3851473 | + | 1713 | Protein_3744 | flagellar biosynthesis protein FlhA | - |
| NLZ08_RS19095 (3851689) | 3851689..3852186 | - | 498 | WP_000006260.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T250793 WP_001263493.1 NZ_CP100530:c3847530-3847132 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|