Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 205393..205615 | Replicon | chromosome |
| Accession | NZ_CP100530 | ||
| Organism | Escherichia coli strain LH10-b-1 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | NLZ08_RS00950 | Protein ID | WP_001295224.1 |
| Coordinates | 205508..205615 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 205393..205451 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ08_RS00925 | 200781..201764 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| NLZ08_RS00930 | 201761..202765 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| NLZ08_RS00935 | 202795..204066 | - | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
| NLZ08_RS00940 | 204542..204649 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| NLZ08_RS00945 | 205025..205132 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 205393..205451 | - | 59 | - | - | Antitoxin |
| NLZ08_RS00950 | 205508..205615 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| NLZ08_RS00955 | 205991..206098 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
| NLZ08_RS00960 | 206185..207864 | - | 1680 | WP_097749325.1 | cellulose biosynthesis protein BcsG | - |
| NLZ08_RS00965 | 207861..208052 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| NLZ08_RS00970 | 208063..208533 | + | 471 | Protein_191 | cell division protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T250777 WP_001295224.1 NZ_CP100530:205508-205615 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT250777 NZ_CP100530:c205451-205393 [Escherichia coli]
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|