Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 204910..205132 | Replicon | chromosome |
Accession | NZ_CP100530 | ||
Organism | Escherichia coli strain LH10-b-1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | NLZ08_RS00945 | Protein ID | WP_001295224.1 |
Coordinates | 205025..205132 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 204910..204967 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ08_RS00925 | 200781..201764 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
NLZ08_RS00930 | 201761..202765 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
NLZ08_RS00935 | 202795..204066 | - | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
NLZ08_RS00940 | 204542..204649 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 204910..204967 | - | 58 | - | - | Antitoxin |
NLZ08_RS00945 | 205025..205132 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
NLZ08_RS00950 | 205508..205615 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
NLZ08_RS00955 | 205991..206098 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
NLZ08_RS00960 | 206185..207864 | - | 1680 | WP_097749325.1 | cellulose biosynthesis protein BcsG | - |
NLZ08_RS00965 | 207861..208052 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
NLZ08_RS00970 | 208063..208533 | + | 471 | Protein_191 | cell division protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T250776 WP_001295224.1 NZ_CP100530:205025-205132 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 58 bp
>AT250776 NZ_CP100530:c204967-204910 [Escherichia coli]
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|