Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3677152..3677846 | Replicon | chromosome |
Accession | NZ_CP100525 | ||
Organism | Escherichia coli strain LH13-b |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | NLZ09_RS18035 | Protein ID | WP_001263493.1 |
Coordinates | 3677152..3677550 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | NLZ09_RS18040 | Protein ID | WP_000554757.1 |
Coordinates | 3677553..3677846 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3672812) | 3672812..3672892 | - | 81 | NuclAT_11 | - | - |
- (3672812) | 3672812..3672892 | - | 81 | NuclAT_11 | - | - |
- (3672812) | 3672812..3672892 | - | 81 | NuclAT_11 | - | - |
- (3672812) | 3672812..3672892 | - | 81 | NuclAT_11 | - | - |
NLZ09_RS18005 (3672152) | 3672152..3673396 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
NLZ09_RS18010 (3673488) | 3673488..3673946 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NLZ09_RS18015 (3674207) | 3674207..3675664 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
NLZ09_RS18020 (3675721) | 3675721..3676242 | - | 522 | Protein_3527 | peptide chain release factor H | - |
NLZ09_RS18025 (3676241) | 3676241..3676444 | - | 204 | Protein_3528 | RtcB family protein | - |
NLZ09_RS18030 (3676690) | 3676690..3677142 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
NLZ09_RS18035 (3677152) | 3677152..3677550 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NLZ09_RS18040 (3677553) | 3677553..3677846 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NLZ09_RS18045 (3677898) | 3677898..3678953 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NLZ09_RS18050 (3679024) | 3679024..3679809 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
NLZ09_RS18055 (3679781) | 3679781..3681493 | + | 1713 | Protein_3534 | flagellar biosynthesis protein FlhA | - |
NLZ09_RS18060 (3681717) | 3681717..3682214 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T250766 WP_001263493.1 NZ_CP100525:c3677550-3677152 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|