Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 733705..734480 | Replicon | chromosome |
| Accession | NZ_CP100520 | ||
| Organism | Klebsiella pneumoniae strain LH13-d | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | NLZ10_RS03705 | Protein ID | WP_048255216.1 |
| Coordinates | 733995..734480 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | NLZ10_RS03700 | Protein ID | WP_004150912.1 |
| Coordinates | 733705..733998 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ10_RS03680 (728914) | 728914..729516 | - | 603 | WP_032442511.1 | short chain dehydrogenase | - |
| NLZ10_RS03685 (729614) | 729614..730525 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| NLZ10_RS03690 (730526) | 730526..731674 | - | 1149 | WP_020316731.1 | PLP-dependent aspartate aminotransferase family protein | - |
| NLZ10_RS03695 (731685) | 731685..733061 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
| NLZ10_RS03700 (733705) | 733705..733998 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| NLZ10_RS03705 (733995) | 733995..734480 | + | 486 | WP_048255216.1 | GNAT family N-acetyltransferase | Toxin |
| NLZ10_RS03710 (735178) | 735178..735771 | + | 594 | Protein_727 | hypothetical protein | - |
| NLZ10_RS03715 (735868) | 735868..736084 | + | 217 | Protein_728 | transposase | - |
| NLZ10_RS03725 (736925) | 736925..737638 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 735868..736020 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17594.62 Da Isoelectric Point: 8.8818
>T250738 WP_048255216.1 NZ_CP100520:733995-734480 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVNKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVNKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|