Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 326263..326849 Replicon chromosome
Accession NZ_CP100515
Organism Klebsiella pneumoniae strain LH35-d

Toxin (Protein)


Gene name doc Uniprot ID A0A486Q6W0
Locus tag NLZ11_RS01515 Protein ID WP_020802489.1
Coordinates 326481..326849 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag NLZ11_RS01510 Protein ID WP_019725146.1
Coordinates 326263..326484 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ11_RS01490 (NLZ11_01490) 322420..323346 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NLZ11_RS01495 (NLZ11_01495) 323343..324620 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NLZ11_RS01500 (NLZ11_01500) 324617..325384 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NLZ11_RS01505 (NLZ11_01505) 325386..326099 + 714 WP_131024535.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NLZ11_RS01510 (NLZ11_01510) 326263..326484 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NLZ11_RS01515 (NLZ11_01515) 326481..326849 + 369 WP_020802489.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NLZ11_RS01520 (NLZ11_01520) 327122..328438 + 1317 WP_159308028.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NLZ11_RS01525 (NLZ11_01525) 328545..329432 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NLZ11_RS01530 (NLZ11_01530) 329429..330274 + 846 WP_065801119.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NLZ11_RS01535 (NLZ11_01535) 330276..331346 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 323343..332083 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T250722 WP_020802489.1 NZ_CP100515:326481-326849 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT250722 WP_019725146.1 NZ_CP100515:326263-326484 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486Q6W0

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References