Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4559890..4560665 | Replicon | chromosome |
Accession | NZ_CP100511 | ||
Organism | Klebsiella pneumoniae strain LH50-a |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | NLZ12_RS22280 | Protein ID | WP_021314147.1 |
Coordinates | 4559890..4560375 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NLZ12_RS22285 | Protein ID | WP_004150912.1 |
Coordinates | 4560372..4560665 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ12_RS22260 (NLZ12_22260) | 4557052..4557765 | + | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
NLZ12_RS22270 (NLZ12_22270) | 4558280..4558496 | - | 217 | Protein_4371 | transposase | - |
NLZ12_RS22275 (NLZ12_22275) | 4558593..4559186 | - | 594 | WP_004188553.1 | hypothetical protein | - |
NLZ12_RS22280 (NLZ12_22280) | 4559890..4560375 | - | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
NLZ12_RS22285 (NLZ12_22285) | 4560372..4560665 | - | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NLZ12_RS22290 (NLZ12_22290) | 4561310..4562686 | + | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
NLZ12_RS22295 (NLZ12_22295) | 4562697..4563845 | + | 1149 | WP_020316731.1 | PLP-dependent aspartate aminotransferase family protein | - |
NLZ12_RS22300 (NLZ12_22300) | 4563846..4564757 | - | 912 | WP_021314148.1 | LysR family transcriptional regulator | - |
NLZ12_RS22305 (NLZ12_22305) | 4564855..4565457 | + | 603 | WP_004174410.1 | short chain dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4558344..4558496 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T250718 WP_021314147.1 NZ_CP100511:c4560375-4559890 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |