Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 326507..327093 | Replicon | chromosome |
Accession | NZ_CP100511 | ||
Organism | Klebsiella pneumoniae strain LH50-a |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A486Q6W0 |
Locus tag | NLZ12_RS01515 | Protein ID | WP_020802489.1 |
Coordinates | 326725..327093 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A483YZZ9 |
Locus tag | NLZ12_RS01510 | Protein ID | WP_019725146.1 |
Coordinates | 326507..326728 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ12_RS01490 (NLZ12_01490) | 322664..323590 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NLZ12_RS01495 (NLZ12_01495) | 323587..324864 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
NLZ12_RS01500 (NLZ12_01500) | 324861..325628 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NLZ12_RS01505 (NLZ12_01505) | 325630..326343 | + | 714 | WP_131024535.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NLZ12_RS01510 (NLZ12_01510) | 326507..326728 | + | 222 | WP_019725146.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NLZ12_RS01515 (NLZ12_01515) | 326725..327093 | + | 369 | WP_020802489.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NLZ12_RS01520 (NLZ12_01520) | 327366..328682 | + | 1317 | WP_159308028.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NLZ12_RS01525 (NLZ12_01525) | 328789..329676 | + | 888 | WP_254541256.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NLZ12_RS01530 (NLZ12_01530) | 329673..330518 | + | 846 | WP_065801119.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NLZ12_RS01535 (NLZ12_01535) | 330520..331590 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 323587..332327 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13542.89 Da Isoelectric Point: 8.6410
>T250706 WP_020802489.1 NZ_CP100511:326725-327093 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486Q6W0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483YZZ9 |