Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 326507..327093 Replicon chromosome
Accession NZ_CP100511
Organism Klebsiella pneumoniae strain LH50-a

Toxin (Protein)


Gene name doc Uniprot ID A0A486Q6W0
Locus tag NLZ12_RS01515 Protein ID WP_020802489.1
Coordinates 326725..327093 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag NLZ12_RS01510 Protein ID WP_019725146.1
Coordinates 326507..326728 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ12_RS01490 (NLZ12_01490) 322664..323590 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NLZ12_RS01495 (NLZ12_01495) 323587..324864 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NLZ12_RS01500 (NLZ12_01500) 324861..325628 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NLZ12_RS01505 (NLZ12_01505) 325630..326343 + 714 WP_131024535.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NLZ12_RS01510 (NLZ12_01510) 326507..326728 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NLZ12_RS01515 (NLZ12_01515) 326725..327093 + 369 WP_020802489.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NLZ12_RS01520 (NLZ12_01520) 327366..328682 + 1317 WP_159308028.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NLZ12_RS01525 (NLZ12_01525) 328789..329676 + 888 WP_254541256.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NLZ12_RS01530 (NLZ12_01530) 329673..330518 + 846 WP_065801119.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NLZ12_RS01535 (NLZ12_01535) 330520..331590 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 323587..332327 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T250706 WP_020802489.1 NZ_CP100511:326725-327093 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT250706 WP_019725146.1 NZ_CP100511:326507-326728 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486Q6W0

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References