Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 62328..62582 | Replicon | plasmid pLH50-c-D |
| Accession | NZ_CP100504 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NLZ13_RS29200 | Protein ID | WP_001312851.1 |
| Coordinates | 62433..62582 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 62328..62384 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS29165 (58264) | 58264..59010 | + | 747 | WP_021534916.1 | conjugal transfer pilus acetylase TraX | - |
| NLZ13_RS29170 (59065) | 59065..59625 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| NLZ13_RS29175 (59756) | 59756..59968 | + | 213 | WP_032161968.1 | hypothetical protein | - |
| NLZ13_RS29180 (60213) | 60213..60674 | + | 462 | WP_001233850.1 | thermonuclease family protein | - |
| NLZ13_RS29185 (60720) | 60720..60929 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| NLZ13_RS29190 (60967) | 60967..61557 | + | 591 | WP_000766807.1 | DUF2726 domain-containing protein | - |
| NLZ13_RS29195 (61712) | 61712..62161 | + | 450 | WP_112038051.1 | hypothetical protein | - |
| - (62328) | 62328..62384 | - | 57 | NuclAT_1 | - | Antitoxin |
| - (62328) | 62328..62384 | - | 57 | NuclAT_1 | - | Antitoxin |
| - (62328) | 62328..62384 | - | 57 | NuclAT_1 | - | Antitoxin |
| - (62328) | 62328..62384 | - | 57 | NuclAT_1 | - | Antitoxin |
| NLZ13_RS29200 (62433) | 62433..62582 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NLZ13_RS29205 (62866) | 62866..63126 | + | 261 | WP_021536205.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..63428 | 63428 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T250704 WP_001312851.1 NZ_CP100504:62433-62582 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 57 bp
>AT250704 NZ_CP100504:c62384-62328 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
