Detailed information of TA system TA250701

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 20571..20997
• Replicon: plasmid pLH50-c-D
• Accession: NZ_CP100504
• Organism: Escherichia coli strain LH50-c

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NLZ13_RS28945
• Protein ID: WP_001372321.1
• Coordinates: 20872..20997 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	20571..20795 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NLZ13_RS28895 (15617)	15617..15877	+	261	WP_249960395.1	hypothetical protein	-
NLZ13_RS28900 (15769)	15769..16047	+	279	WP_254539453.1	hypothetical protein	-
NLZ13_RS28905 (16055)	16055..16216	-	162	Protein_26	hypothetical protein	-
NLZ13_RS28910 (16518)	16518..17045	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
NLZ13_RS28915 (17101)	17101..17334	+	234	WP_000006012.1	DUF905 family protein	-
NLZ13_RS28920 (17398)	17398..19354	+	1957	Protein_29	ParB/RepB/Spo0J family partition protein	-
NLZ13_RS28925 (19409)	19409..19843	+	435	WP_021534892.1	conjugation system SOS inhibitor PsiB	-
NLZ13_RS28930 (19840)	19840..20602	+	763	Protein_31	plasmid SOS inhibition protein A	-
NLZ13_RS28935 (20571)	20571..20759	-	189	WP_001299721.1	hypothetical protein	-
- (20571)	20571..20795	+	225	NuclAT_0	-	Antitoxin
- (20571)	20571..20795	+	225	NuclAT_0	-	Antitoxin
- (20571)	20571..20795	+	225	NuclAT_0	-	Antitoxin
- (20571)	20571..20795	+	225	NuclAT_0	-	Antitoxin
NLZ13_RS28940 (20781)	20781..20930	+	150	Protein_33	plasmid maintenance protein Mok	-
NLZ13_RS28945 (20872)	20872..20997	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NLZ13_RS28950 (21444)	21444..21617	-	174	Protein_35	hypothetical protein	-
NLZ13_RS28955 (21918)	21918..22205	+	288	WP_000107526.1	hypothetical protein	-
NLZ13_RS28960 (22324)	22324..23145	+	822	WP_032172795.1	DUF932 domain-containing protein	-
NLZ13_RS28965 (23440)	23440..24042	-	603	WP_112038064.1	transglycosylase SLT domain-containing protein	-
NLZ13_RS28970 (24365)	24365..24748	+	384	WP_001342639.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NLZ13_RS28975 (24939)	24939..25382	+	444	WP_249960394.1	hypothetical protein	-
NLZ13_RS28980 (25716)	25716..25943	+	228	WP_097413801.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..63428	63428

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T250701 WP_001372321.1 NZ_CP100504:20872-20997 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT250701 NZ_CP100504:20571-20795 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin