Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5343666..5344268 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NLZ13_RS25975 | Protein ID | WP_000897305.1 |
| Coordinates | 5343957..5344268 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NLZ13_RS25970 | Protein ID | WP_000356397.1 |
| Coordinates | 5343666..5343956 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS25945 (5339613) | 5339613..5340515 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NLZ13_RS25950 (5340512) | 5340512..5341147 | + | 636 | WP_000829031.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NLZ13_RS25955 (5341144) | 5341144..5342073 | + | 930 | WP_000027691.1 | formate dehydrogenase accessory protein FdhE | - |
| NLZ13_RS25960 (5342403) | 5342403..5342645 | - | 243 | WP_001086385.1 | protein YiiF | - |
| NLZ13_RS25965 (5342864) | 5342864..5343082 | - | 219 | WP_001313440.1 | CopG family transcriptional regulator | - |
| NLZ13_RS25970 (5343666) | 5343666..5343956 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NLZ13_RS25975 (5343957) | 5343957..5344268 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NLZ13_RS25980 (5344497) | 5344497..5345405 | + | 909 | WP_023155176.1 | alpha/beta hydrolase | - |
| NLZ13_RS25985 (5345573) | 5345573..5346487 | - | 915 | WP_191663692.1 | transposase | - |
| NLZ13_RS25990 (5346497) | 5346497..5347387 | - | 891 | Protein_5095 | hypothetical protein | - |
| NLZ13_RS25995 (5347798) | 5347798..5348739 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
| NLZ13_RS26000 (5348784) | 5348784..5349221 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12172.16 Da Isoelectric Point: 9.7791
>T250691 WP_000897305.1 NZ_CP100500:c5344268-5343957 [Escherichia coli]
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|