Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 665208..666007 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NLZ13_RS03255 | Protein ID | WP_000347273.1 |
Coordinates | 665208..665672 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NLZ13_RS03260 | Protein ID | WP_001307405.1 |
Coordinates | 665672..666007 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS03225 (660209) | 660209..660643 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NLZ13_RS03230 (660661) | 660661..661539 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NLZ13_RS03235 (661529) | 661529..662308 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NLZ13_RS03240 (662319) | 662319..662792 | - | 474 | WP_001626031.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NLZ13_RS03245 (662815) | 662815..664095 | - | 1281 | WP_000681939.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NLZ13_RS03250 (664344) | 664344..665153 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NLZ13_RS03255 (665208) | 665208..665672 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NLZ13_RS03260 (665672) | 665672..666007 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NLZ13_RS03265 (666156) | 666156..667727 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
NLZ13_RS03270 (668102) | 668102..669436 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NLZ13_RS03275 (669452) | 669452..670222 | + | 771 | WP_001058233.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T250669 WP_000347273.1 NZ_CP100500:c665672-665208 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |