Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4283024..4283727 | Replicon | chromosome |
Accession | NZ_CP100494 | ||
Organism | Atlantibacter subterranea strain LH84-a |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | NLZ15_RS20380 | Protein ID | WP_254487279.1 |
Coordinates | 4283428..4283727 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | NLZ15_RS20375 | Protein ID | WP_125294704.1 |
Coordinates | 4283024..4283425 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ15_RS20340 (NLZ15_20340) | 4278252..4279010 | + | 759 | WP_254487269.1 | phosphonate C-P lyase system protein PhnK | - |
NLZ15_RS20345 (NLZ15_20345) | 4279020..4279718 | + | 699 | WP_125294698.1 | phosphonate C-P lyase system protein PhnL | - |
NLZ15_RS20350 (NLZ15_20350) | 4279705..4280841 | + | 1137 | WP_254487271.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
NLZ15_RS20355 (NLZ15_20355) | 4280841..4281410 | + | 570 | WP_254487273.1 | ribose 1,5-bisphosphokinase | - |
NLZ15_RS20360 (NLZ15_20360) | 4281400..4281831 | + | 432 | WP_254487275.1 | aminoalkylphosphonate N-acetyltransferase | - |
NLZ15_RS20365 (NLZ15_20365) | 4281841..4282599 | + | 759 | WP_254487277.1 | phosphonate metabolism protein PhnP | - |
NLZ15_RS20370 (NLZ15_20370) | 4282596..4282919 | - | 324 | WP_125294703.1 | DDRRRQL repeat protein YjdP | - |
NLZ15_RS20375 (NLZ15_20375) | 4283024..4283425 | - | 402 | WP_125294704.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NLZ15_RS20380 (NLZ15_20380) | 4283428..4283727 | - | 300 | WP_254487279.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
NLZ15_RS20385 (NLZ15_20385) | 4283805..4286372 | - | 2568 | WP_254487281.1 | ATP-binding protein | - |
NLZ15_RS20390 (NLZ15_20390) | 4286680..4288203 | + | 1524 | WP_254487283.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11312.32 Da Isoelectric Point: 9.7330
>T250651 WP_254487279.1 NZ_CP100494:c4283727-4283428 [Atlantibacter subterranea]
MEKRTPHTRLHIVKMMVRAGLAAITNSALTGAVQMGFGSKQEIFNVILALEPADFYKSMTAYHDSTCWHEVYRPLYKGQR
IYMKFIVTDGVLIVSFKEL
MEKRTPHTRLHIVKMMVRAGLAAITNSALTGAVQMGFGSKQEIFNVILALEPADFYKSMTAYHDSTCWHEVYRPLYKGQR
IYMKFIVTDGVLIVSFKEL
Download Length: 300 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 15037.25 Da Isoelectric Point: 7.6992
>AT250651 WP_125294704.1 NZ_CP100494:c4283425-4283024 [Atlantibacter subterranea]
MKCPVCGGAELLHESRDMQYEYKGRKTVFHAVKGQFCDRCGEVIFGDGEGDEYFAGMVEFNRRVNAEEVDPAFIAKVRKR
LKLDQRQAAEIFGGGANAFSRYETGRVAPPRPLVLLFKALDKHPELLEELKRA
MKCPVCGGAELLHESRDMQYEYKGRKTVFHAVKGQFCDRCGEVIFGDGEGDEYFAGMVEFNRRVNAEEVDPAFIAKVRKR
LKLDQRQAAEIFGGGANAFSRYETGRVAPPRPLVLLFKALDKHPELLEELKRA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|