Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3595853..3596682 | Replicon | chromosome |
Accession | NZ_CP100494 | ||
Organism | Atlantibacter subterranea strain LH84-a |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | NLZ15_RS16900 | Protein ID | WP_254486791.1 |
Coordinates | 3595853..3596335 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | NLZ15_RS16905 | Protein ID | WP_125295554.1 |
Coordinates | 3596338..3596682 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ15_RS16875 (NLZ15_16875) | 3591109..3591324 | - | 216 | WP_125295548.1 | DUF2754 domain-containing protein | - |
NLZ15_RS16880 (NLZ15_16880) | 3591609..3591926 | + | 318 | WP_125295549.1 | DUF2755 family protein | - |
NLZ15_RS16885 (NLZ15_16885) | 3591929..3593014 | - | 1086 | WP_144130042.1 | DUF1615 domain-containing protein | - |
NLZ15_RS16890 (NLZ15_16890) | 3593019..3594247 | - | 1229 | Protein_3308 | peptide antibiotic transporter SbmA | - |
NLZ15_RS16895 (NLZ15_16895) | 3594650..3595801 | + | 1152 | WP_225989986.1 | D-alanyl-D-alanine- carboxypeptidase/endopeptidase AmpH | - |
NLZ15_RS16900 (NLZ15_16900) | 3595853..3596335 | - | 483 | WP_254486791.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
NLZ15_RS16905 (NLZ15_16905) | 3596338..3596682 | - | 345 | WP_125295554.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
NLZ15_RS16910 (NLZ15_16910) | 3596836..3597813 | + | 978 | WP_125295555.1 | porphobilinogen synthase | - |
NLZ15_RS16915 (NLZ15_16915) | 3597944..3598255 | - | 312 | WP_125295556.1 | acid resistance repetitive basic protein Asr | - |
NLZ15_RS16920 (NLZ15_16920) | 3598427..3599887 | - | 1461 | WP_125295557.1 | anion permease | - |
NLZ15_RS16925 (NLZ15_16925) | 3599944..3600549 | - | 606 | WP_125295558.1 | L(+)-tartrate dehydratase subunit beta | - |
NLZ15_RS16930 (NLZ15_16930) | 3600546..3601454 | - | 909 | WP_125295559.1 | L(+)-tartrate dehydratase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 18528.30 Da Isoelectric Point: 10.1532
>T250649 WP_254486791.1 NZ_CP100494:c3596335-3595853 [Atlantibacter subterranea]
MNGMRAVGPWKVYQHPCFVAQVKALRDEVTALKHHYPDDYRNKAATRLLAAINNARKDISADPTQAKFRLGDTLGAGYRH
WFRAKFLGQYRLFFRYSLRERIIILAWVNDSQTKRAYGNKRDAYKVFGEMLASGYPPDDWEALLKETMKQVSLSLCEPQP
MNGMRAVGPWKVYQHPCFVAQVKALRDEVTALKHHYPDDYRNKAATRLLAAINNARKDISADPTQAKFRLGDTLGAGYRH
WFRAKFLGQYRLFFRYSLRERIIILAWVNDSQTKRAYGNKRDAYKVFGEMLASGYPPDDWEALLKETMKQVSLSLCEPQP
Download Length: 483 bp
Antitoxin
Download Length: 115 a.a. Molecular weight: 12402.85 Da Isoelectric Point: 3.9590
>AT250649 WP_125295554.1 NZ_CP100494:c3596682-3596338 [Atlantibacter subterranea]
MNNVVMAGVTLRASSKLTARSQTTIPASVRDAMNLKPGEEIEYAVLADGQVLMTRKQTDAEDDPVMEGFLSFLANDIQHN
PSQIHALDTAFWDDVEALTEGVDVDLDAPLADEK
MNNVVMAGVTLRASSKLTARSQTTIPASVRDAMNLKPGEEIEYAVLADGQVLMTRKQTDAEDDPVMEGFLSFLANDIQHN
PSQIHALDTAFWDDVEALTEGVDVDLDAPLADEK
Download Length: 345 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|