Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3027153..3027799 | Replicon | chromosome |
Accession | NZ_CP100494 | ||
Organism | Atlantibacter subterranea strain LH84-a |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NLZ15_RS14270 | Protein ID | WP_254486466.1 |
Coordinates | 3027446..3027799 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NLZ15_RS14265 | Protein ID | WP_125291701.1 |
Coordinates | 3027153..3027449 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ15_RS14255 (NLZ15_14255) | 3024792..3025646 | - | 855 | WP_254486465.1 | DNA-3-methyladenine glycosylase 2 | - |
NLZ15_RS14260 (NLZ15_14260) | 3025778..3027130 | + | 1353 | WP_254489029.1 | molecular chaperone | - |
NLZ15_RS14265 (NLZ15_14265) | 3027153..3027449 | - | 297 | WP_125291701.1 | XRE family transcriptional regulator | Antitoxin |
NLZ15_RS14270 (NLZ15_14270) | 3027446..3027799 | - | 354 | WP_254486466.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLZ15_RS14275 (NLZ15_14275) | 3028027..3029253 | + | 1227 | WP_254486467.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
NLZ15_RS14280 (NLZ15_14280) | 3029253..3032375 | + | 3123 | WP_144130447.1 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13794.97 Da Isoelectric Point: 10.1483
>T250647 WP_254486466.1 NZ_CP100494:c3027799-3027446 [Atlantibacter subterranea]
MTWTVVFTPEFEQWLYDQEPGLKNRVNAALLTLELTGPALGRPRVDTLFGSFYPNMKELRLQYAGDPWRICFAFDYSRQA
IMLYGGKKTGQKRFYRTLITRVDAIFARYLARKKDRE
MTWTVVFTPEFEQWLYDQEPGLKNRVNAALLTLELTGPALGRPRVDTLFGSFYPNMKELRLQYAGDPWRICFAFDYSRQA
IMLYGGKKTGQKRFYRTLITRVDAIFARYLARKKDRE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|