Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 42076..42340 Replicon plasmid pLH85-a-B
Accession NZ_CP100488
Organism Escherichia coli strain LH85-a

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag NLZ16_RS25200 Protein ID WP_001303307.1
Coordinates 42188..42340 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 42076..42138 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ16_RS25185 (37315) 37315..39606 - 2292 WP_001289271.1 F-type conjugative transfer protein TrbC -
NLZ16_RS25190 (39599) 39599..40669 - 1071 WP_000151575.1 IncI1-type conjugal transfer protein TrbB -
NLZ16_RS25195 (40688) 40688..41896 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (42076) 42076..42138 - 63 NuclAT_0 - Antitoxin
- (42076) 42076..42138 - 63 NuclAT_0 - Antitoxin
- (42076) 42076..42138 - 63 NuclAT_0 - Antitoxin
- (42076) 42076..42138 - 63 NuclAT_0 - Antitoxin
NLZ16_RS25200 (42188) 42188..42340 + 153 WP_001303307.1 Hok/Gef family protein Toxin
NLZ16_RS25205 (42412) 42412..42663 - 252 WP_001291965.1 hypothetical protein -
- (43050) 43050..43101 - 52 NuclAT_1 - -
- (43050) 43050..43101 - 52 NuclAT_1 - -
- (43050) 43050..43101 - 52 NuclAT_1 - -
- (43050) 43050..43101 - 52 NuclAT_1 - -
NLZ16_RS25210 (43587) 43587..43763 - 177 WP_001054900.1 hypothetical protein -
NLZ16_RS25215 (44155) 44155..44364 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NLZ16_RS25220 (44436) 44436..45098 - 663 WP_045721922.1 plasmid IncI1-type surface exclusion protein ExcA -
NLZ16_RS25225 (45163) 45163..47325 - 2163 WP_045721921.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..87908 87908


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T250635 WP_001303307.1 NZ_CP100488:42188-42340 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT250635 NZ_CP100488:c42138-42076 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References