Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4892534..4893136 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NLZ16_RS23400 | Protein ID | WP_000897305.1 |
| Coordinates | 4892825..4893136 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NLZ16_RS23395 | Protein ID | WP_000356395.1 |
| Coordinates | 4892534..4892824 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS23360 (4888158) | 4888158..4889060 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NLZ16_RS23365 (4889057) | 4889057..4889692 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NLZ16_RS23370 (4889689) | 4889689..4890618 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NLZ16_RS23375 (4890800) | 4890800..4891042 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| NLZ16_RS23380 (4891261) | 4891261..4891479 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NLZ16_RS23385 (4891898) | 4891898..4892176 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| NLZ16_RS23390 (4892228) | 4892228..4892449 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| NLZ16_RS23395 (4892534) | 4892534..4892824 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| NLZ16_RS23400 (4892825) | 4892825..4893136 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NLZ16_RS23405 (4893365) | 4893365..4894273 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| NLZ16_RS23410 (4894441) | 4894441..4895355 | - | 915 | WP_109553727.1 | transposase | - |
| NLZ16_RS23415 (4895368) | 4895368..4896255 | - | 888 | Protein_4579 | hypothetical protein | - |
| NLZ16_RS23420 (4896671) | 4896671..4897612 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NLZ16_RS23425 (4897657) | 4897657..4898094 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T250632 WP_000897305.1 NZ_CP100486:c4893136-4892825 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|