Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3929266..3929960 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NLZ16_RS18745 | Protein ID | WP_001263491.1 |
| Coordinates | 3929266..3929664 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NLZ16_RS18750 | Protein ID | WP_000554755.1 |
| Coordinates | 3929667..3929960 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3925095) | 3925095..3925175 | - | 81 | NuclAT_11 | - | - |
| - (3925095) | 3925095..3925175 | - | 81 | NuclAT_11 | - | - |
| - (3925095) | 3925095..3925175 | - | 81 | NuclAT_11 | - | - |
| - (3925095) | 3925095..3925175 | - | 81 | NuclAT_11 | - | - |
| NLZ16_RS18715 (3924435) | 3924435..3925679 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NLZ16_RS18720 (3925771) | 3925771..3926229 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NLZ16_RS18725 (3926490) | 3926490..3927947 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NLZ16_RS18730 (3928004) | 3928004..3928356 | - | 353 | Protein_3667 | peptide chain release factor H | - |
| NLZ16_RS18735 (3928352) | 3928352..3928558 | - | 207 | Protein_3668 | RtcB family protein | - |
| NLZ16_RS18740 (3928804) | 3928804..3929256 | - | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| NLZ16_RS18745 (3929266) | 3929266..3929664 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NLZ16_RS18750 (3929667) | 3929667..3929960 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NLZ16_RS18755 (3930012) | 3930012..3931067 | - | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| NLZ16_RS18760 (3931138) | 3931138..3931923 | - | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| NLZ16_RS18765 (3931895) | 3931895..3933607 | + | 1713 | Protein_3674 | flagellar biosynthesis protein FlhA | - |
| NLZ16_RS18770 (3933712) | 3933712..3933990 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NLZ16_RS18775 (3933983) | 3933983..3934339 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3919202..3929960 | 10758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T250627 WP_001263491.1 NZ_CP100486:c3929664-3929266 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |