Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3929266..3929960 Replicon chromosome
Accession NZ_CP100486
Organism Escherichia coli strain LH85-a

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NLZ16_RS18745 Protein ID WP_001263491.1
Coordinates 3929266..3929664 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NLZ16_RS18750 Protein ID WP_000554755.1
Coordinates 3929667..3929960 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3925095) 3925095..3925175 - 81 NuclAT_11 - -
- (3925095) 3925095..3925175 - 81 NuclAT_11 - -
- (3925095) 3925095..3925175 - 81 NuclAT_11 - -
- (3925095) 3925095..3925175 - 81 NuclAT_11 - -
NLZ16_RS18715 (3924435) 3924435..3925679 - 1245 WP_000189541.1 esterase FrsA -
NLZ16_RS18720 (3925771) 3925771..3926229 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NLZ16_RS18725 (3926490) 3926490..3927947 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NLZ16_RS18730 (3928004) 3928004..3928356 - 353 Protein_3667 peptide chain release factor H -
NLZ16_RS18735 (3928352) 3928352..3928558 - 207 Protein_3668 RtcB family protein -
NLZ16_RS18740 (3928804) 3928804..3929256 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NLZ16_RS18745 (3929266) 3929266..3929664 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NLZ16_RS18750 (3929667) 3929667..3929960 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NLZ16_RS18755 (3930012) 3930012..3931067 - 1056 WP_001550655.1 DNA polymerase IV -
NLZ16_RS18760 (3931138) 3931138..3931923 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NLZ16_RS18765 (3931895) 3931895..3933607 + 1713 Protein_3674 flagellar biosynthesis protein FlhA -
NLZ16_RS18770 (3933712) 3933712..3933990 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NLZ16_RS18775 (3933983) 3933983..3934339 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3919202..3929960 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T250627 WP_001263491.1 NZ_CP100486:c3929664-3929266 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT250627 WP_000554755.1 NZ_CP100486:c3929960-3929667 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References