Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2024790..2025450 | Replicon | chromosome |
Accession | NZ_CP100482 | ||
Organism | Klebsiella grimontii strain LH87-a |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NLZ17_RS09650 | Protein ID | WP_154975687.1 |
Coordinates | 2024790..2025143 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A9E1DQ94 |
Locus tag | NLZ17_RS09655 | Protein ID | WP_004132739.1 |
Coordinates | 2025148..2025450 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ17_RS09625 (NLZ17_09625) | 2020174..2020941 | - | 768 | WP_154975688.1 | molybdopterin-dependent oxidoreductase | - |
NLZ17_RS09630 (NLZ17_09630) | 2020931..2021539 | - | 609 | WP_004132729.1 | cytochrome b/b6 domain-containing protein | - |
NLZ17_RS09635 (NLZ17_09635) | 2021554..2022180 | - | 627 | WP_004132731.1 | hypothetical protein | - |
NLZ17_RS09640 (NLZ17_09640) | 2022320..2022988 | + | 669 | WP_004132733.1 | heavy metal response regulator transcription factor | - |
NLZ17_RS09645 (NLZ17_09645) | 2022988..2024406 | + | 1419 | WP_064411585.1 | heavy metal sensor histidine kinase | - |
NLZ17_RS09650 (NLZ17_09650) | 2024790..2025143 | + | 354 | WP_154975687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLZ17_RS09655 (NLZ17_09655) | 2025148..2025450 | + | 303 | WP_004132739.1 | XRE family transcriptional regulator | Antitoxin |
NLZ17_RS09660 (NLZ17_09660) | 2025644..2025847 | + | 204 | Protein_1894 | hypothetical protein | - |
NLZ17_RS09665 (NLZ17_09665) | 2025848..2026180 | + | 333 | WP_024359977.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
NLZ17_RS09675 (NLZ17_09675) | 2026503..2027960 | + | 1458 | WP_004136541.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NLZ17_RS09685 (NLZ17_09685) | 2028990..2030444 | - | 1455 | WP_024359975.1 | AMP nucleosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13614.64 Da Isoelectric Point: 10.3329
>T250600 WP_154975687.1 NZ_CP100482:2024790-2025143 [Klebsiella grimontii]
VWMIKTTDTFERWFTSFNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSNMKELRIQSRGEPIRAFFAFGPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
VWMIKTTDTFERWFTSFNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSNMKELRIQSRGEPIRAFFAFGPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|