Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2277559..2277743 | Replicon | chromosome |
| Accession | NZ_CP100428 | ||
| Organism | Staphylococcus aureus strain RMSA24 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | NLG45_RS11205 | Protein ID | WP_000482647.1 |
| Coordinates | 2277559..2277666 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2277683..2277743 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG45_RS11180 (NLG45_11180) | 2272932..2273405 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| NLG45_RS11185 (NLG45_11185) | 2273528..2274739 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| NLG45_RS11190 (NLG45_11190) | 2274921..2275580 | - | 660 | WP_000831298.1 | membrane protein | - |
| NLG45_RS11195 (NLG45_11195) | 2275640..2276781 | - | 1142 | Protein_2201 | glycerate kinase | - |
| NLG45_RS11200 (NLG45_11200) | 2277039..2277425 | + | 387 | WP_000779360.1 | flippase GtxA | - |
| NLG45_RS11205 (NLG45_11205) | 2277559..2277666 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2277683..2277743 | - | 61 | - | - | Antitoxin |
| NLG45_RS11210 (NLG45_11210) | 2278370..2280133 | + | 1764 | WP_254414320.1 | ABC transporter ATP-binding protein | - |
| NLG45_RS11215 (NLG45_11215) | 2280158..2281891 | + | 1734 | Protein_2205 | ABC transporter ATP-binding protein/permease | - |
| NLG45_RS11220 (NLG45_11220) | 2282122..2282289 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T250540 WP_000482647.1 NZ_CP100428:2277559-2277666 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT250540 NZ_CP100428:c2277743-2277683 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|