250536

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1624690..1625104 Replicon chromosome
Accession NZ_CP100428
Organism Staphylococcus aureus strain RMSA24

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NLG45_RS08155 Protein ID WP_031883898.1
Coordinates 1624853..1625104 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NLG45_RS08150 Protein ID WP_000028424.1
Coordinates 1624690..1624863 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLG45_RS08105 (NLG45_08105) 1619956..1620060 + 105 WP_078098968.1 hypothetical protein -
NLG45_RS08110 (NLG45_08110) 1620162..1622609 - 2448 WP_031883900.1 virulence-associated E family protein -
NLG45_RS08115 (NLG45_08115) 1622661..1622861 - 201 WP_000265258.1 DUF1514 family protein -
NLG45_RS08120 (NLG45_08120) 1622929..1623081 - 153 WP_000595263.1 transcriptional activator RinB -
NLG45_RS08125 (NLG45_08125) 1623078..1623464 - 387 WP_000592219.1 hypothetical protein -
NLG45_RS08130 (NLG45_08130) 1623461..1623667 - 207 WP_000195812.1 DUF1381 domain-containing protein -
NLG45_RS08135 (NLG45_08135) 1623704..1624231 - 528 WP_031883899.1 dUTPase -
NLG45_RS08140 (NLG45_08140) 1624246..1624407 - 162 WP_180991751.1 hypothetical protein -
NLG45_RS08145 (NLG45_08145) 1624408..1624689 - 282 WP_000454994.1 hypothetical protein -
NLG45_RS08150 (NLG45_08150) 1624690..1624863 - 174 WP_000028424.1 hypothetical protein Antitoxin
NLG45_RS08155 (NLG45_08155) 1624853..1625104 - 252 WP_031883898.1 DUF1024 family protein Toxin
NLG45_RS08160 (NLG45_08160) 1625097..1625381 - 285 WP_031883897.1 hypothetical protein -
NLG45_RS08165 (NLG45_08165) 1625378..1625815 - 438 WP_031796778.1 YopX family protein -
NLG45_RS08170 (NLG45_08170) 1625812..1626006 - 195 WP_031794818.1 hypothetical protein -
NLG45_RS08175 (NLG45_08175) 1626003..1626410 - 408 WP_000695771.1 hypothetical protein -
NLG45_RS08180 (NLG45_08180) 1626413..1626619 - 207 WP_000693993.1 hypothetical protein -
NLG45_RS08185 (NLG45_08185) 1626634..1626882 - 249 WP_000178883.1 phi PVL orf 51-like protein -
NLG45_RS08190 (NLG45_08190) 1626891..1627091 - 201 WP_031796775.1 hypothetical protein -
NLG45_RS08195 (NLG45_08195) 1627094..1627351 - 258 WP_000111488.1 DUF3310 domain-containing protein -
NLG45_RS08200 (NLG45_08200) 1627351..1627752 - 402 WP_000113981.1 PVL family protein -
NLG45_RS08205 (NLG45_08205) 1627752..1627937 - 186 WP_001164628.1 DUF3113 family protein -
NLG45_RS08210 (NLG45_08210) 1627950..1629902 - 1953 WP_078055733.1 DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - geh / geh 1593456..1649804 56348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9364.22 Da        Isoelectric Point: 3.6767

>T250536 WP_031883898.1 NZ_CP100428:c1625104-1624853 [Staphylococcus aureus]
MDNREQIEQSVISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT250536 WP_000028424.1 NZ_CP100428:c1624863-1624690 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References