Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 22496..23153 Replicon plasmid p104486766-qnrVF1
Accession NZ_CP100424
Organism Vibrio furnissii strain 104486766

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag NIN90_RS23705 Protein ID WP_000270043.1
Coordinates 22803..23153 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NIN90_RS23700 Protein ID WP_000124640.1
Coordinates 22496..22798 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIN90_RS23655 18121..18549 + 429 WP_000591074.1 hypothetical protein -
NIN90_RS23660 18606..18965 + 360 WP_000422768.1 hypothetical protein -
NIN90_RS23665 18965..19411 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
NIN90_RS23670 19408..19926 + 519 WP_000210756.1 nitrite reductase -
NIN90_RS23675 19926..20156 + 231 WP_000972663.1 hypothetical protein -
NIN90_RS23680 20143..21000 + 858 WP_001167032.1 hypothetical protein -
NIN90_RS23685 21231..21758 + 528 WP_001236377.1 thermonuclease family protein -
NIN90_RS23690 21816..22088 + 273 WP_001043047.1 HU family DNA-binding protein -
NIN90_RS23695 22176..22469 + 294 WP_001239997.1 chromosome segregation protein ParM -
NIN90_RS23700 22496..22798 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
NIN90_RS23705 22803..23153 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIN90_RS23710 23316..23864 + 549 WP_001061574.1 transcriptional regulator -
NIN90_RS23715 24205..24399 + 195 WP_000343597.1 hypothetical protein -
NIN90_RS23720 24410..24781 + 372 WP_000516916.1 hypothetical protein -
NIN90_RS23725 24774..25244 + 471 WP_001281821.1 hypothetical protein -
NIN90_RS23730 25259..25594 - 336 WP_000683476.1 hypothetical protein -
NIN90_RS23735 25691..26179 + 489 WP_001273096.1 DUF1643 domain-containing protein -
NIN90_RS23740 26182..26679 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IId / tet(D) / floR / sul2 / ARR-3 / dfrA27 / qacE / sul1 / blaPER-1 / mph(A) - 1..198507 198507


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T250534 WP_000270043.1 NZ_CP100424:c23153-22803 [Vibrio furnissii]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT250534 WP_000124640.1 NZ_CP100424:c22798-22496 [Vibrio furnissii]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References