Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1224542..1225269 | Replicon | chromosome |
| Accession | NZ_CP100388 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain VKH10 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J0Q486 |
| Locus tag | LZ581_RS05770 | Protein ID | WP_033486526.1 |
| Coordinates | 1224958..1225269 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LZ581_RS05765 | Protein ID | WP_045907165.1 |
| Coordinates | 1224542..1224961 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ581_RS05755 (LZ581_05755) | 1222372..1223493 | - | 1122 | WP_015571201.1 | YbdK family carboxylate-amine ligase | - |
| LZ581_RS05760 (LZ581_05760) | 1223599..1224489 | + | 891 | WP_033486528.1 | oxidoreductase | - |
| LZ581_RS05765 (LZ581_05765) | 1224542..1224961 | - | 420 | WP_045907165.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LZ581_RS05770 (LZ581_05770) | 1224958..1225269 | - | 312 | WP_033486526.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LZ581_RS05775 (LZ581_05775) | 1225734..1226816 | - | 1083 | WP_128771668.1 | LysR family transcriptional regulator | - |
| LZ581_RS05780 (LZ581_05780) | 1226821..1227312 | + | 492 | WP_128771667.1 | GNAT family N-acetyltransferase | - |
| LZ581_RS05785 (LZ581_05785) | 1227407..1228864 | + | 1458 | WP_058689341.1 | amino acid permease | - |
| LZ581_RS05790 (LZ581_05790) | 1229090..1229608 | - | 519 | WP_058688860.1 | N-acetyltransferase | - |
| LZ581_RS05795 (LZ581_05795) | 1229635..1230096 | - | 462 | WP_048229285.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12506.30 Da Isoelectric Point: 9.9435
>T250499 WP_033486526.1 NZ_CP100388:c1225269-1224958 [Enterobacter hormaechei subsp. steigerwaltii]
MHIVSRAPFDTAARHYPNQAQALDDLYRVLKKEHYPSPDEMRKRFPSLDRMKYREKWWVIDVGGGHLRVMFFADFERGKI
FIKHISTHADYDKLTDYYRRTKE
MHIVSRAPFDTAARHYPNQAQALDDLYRVLKKEHYPSPDEMRKRFPSLDRMKYREKWWVIDVGGGHLRVMFFADFERGKI
FIKHISTHADYDKLTDYYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15419.46 Da Isoelectric Point: 4.5849
>AT250499 WP_045907165.1 NZ_CP100388:c1224961-1224542 [Enterobacter hormaechei subsp. steigerwaltii]
MNYAAAIKAANALTNELPFLGSSPSRQDYEDALALVEYLIEHDPDNPLVDMLTDKIDKYENASPEFAEFNARIASIPSGV
ALLRTLMDQYQLTQSDFENEIGKKSLVSRILNGQRTLTLDHMRALAKRFGLPVSAFVGN
MNYAAAIKAANALTNELPFLGSSPSRQDYEDALALVEYLIEHDPDNPLVDMLTDKIDKYENASPEFAEFNARIASIPSGV
ALLRTLMDQYQLTQSDFENEIGKKSLVSRILNGQRTLTLDHMRALAKRFGLPVSAFVGN
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|