Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 41942..42600 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP100306 | ||
| Organism | Acinetobacter baumannii strain KBN10P05679 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIK71_RS19630 | Protein ID | WP_000312250.1 |
| Coordinates | 42241..42600 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIK71_RS19625 | Protein ID | WP_001096429.1 |
| Coordinates | 41942..42241 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIK71_RS19580 (NIK71_19580) | 36975..37232 | + | 258 | WP_000834292.1 | hypothetical protein | - |
| NIK71_RS19585 (NIK71_19585) | 37237..37809 | + | 573 | WP_000429351.1 | hypothetical protein | - |
| NIK71_RS19590 (NIK71_19590) | 37785..37964 | + | 180 | WP_002081921.1 | hypothetical protein | - |
| NIK71_RS19595 (NIK71_19595) | 37981..38610 | + | 630 | WP_002081923.1 | hypothetical protein | - |
| NIK71_RS19600 (NIK71_19600) | 38650..39159 | + | 510 | WP_001043199.1 | hypothetical protein | - |
| NIK71_RS19605 (NIK71_19605) | 39240..39794 | + | 555 | WP_000790085.1 | hypothetical protein | - |
| NIK71_RS19610 (NIK71_19610) | 39844..40380 | + | 537 | WP_000731981.1 | hypothetical protein | - |
| NIK71_RS19615 (NIK71_19615) | 41003..41485 | + | 483 | WP_001052677.1 | hypothetical protein | - |
| NIK71_RS19620 (NIK71_19620) | 41578..41841 | - | 264 | WP_000110863.1 | hypothetical protein | - |
| NIK71_RS19625 (NIK71_19625) | 41942..42241 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| NIK71_RS19630 (NIK71_19630) | 42241..42600 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIK71_RS19635 (NIK71_19635) | 42801..43367 | + | 567 | WP_041171756.1 | hypothetical protein | - |
| NIK71_RS19640 (NIK71_19640) | 43416..43598 | + | 183 | WP_000373385.1 | hypothetical protein | - |
| NIK71_RS19645 (NIK71_19645) | 43665..44363 | + | 699 | WP_000873190.1 | hypothetical protein | - |
| NIK71_RS19650 (NIK71_19650) | 44502..44885 | + | 384 | WP_000654349.1 | hypothetical protein | - |
| NIK71_RS19655 (NIK71_19655) | 44952..45710 | + | 759 | WP_001053129.1 | hypothetical protein | - |
| NIK71_RS19660 (NIK71_19660) | 46778..47092 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..74294 | 74294 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T250403 WP_000312250.1 NZ_CP100306:c42600-42241 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|