Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2564752..2565345 | Replicon | chromosome |
Accession | NZ_CP100128 | ||
Organism | Chromobacterium sp. IIBBL 290-4 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | NKT35_RS24045 | Protein ID | WP_256493448.1 |
Coordinates | 2564752..2565030 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NKT35_RS11775 | Protein ID | WP_254293123.1 |
Coordinates | 2565043..2565345 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NKT35_RS11745 (NKT35_11745) | 2562242..2562544 | - | 303 | WP_254293111.1 | BrnA antitoxin family protein | - |
NKT35_RS11750 (NKT35_11750) | 2562555..2562863 | - | 309 | WP_254293113.1 | hypothetical protein | - |
NKT35_RS11755 (NKT35_11755) | 2563069..2563410 | - | 342 | WP_254293115.1 | hypothetical protein | - |
NKT35_RS11760 (NKT35_11760) | 2563407..2563889 | - | 483 | WP_254293117.1 | hypothetical protein | - |
NKT35_RS11765 (NKT35_11765) | 2563886..2564260 | - | 375 | WP_254293119.1 | hypothetical protein | - |
NKT35_RS24045 | 2564752..2565030 | + | 279 | WP_256493448.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NKT35_RS11775 (NKT35_11775) | 2565043..2565345 | + | 303 | WP_254293123.1 | HigA family addiction module antitoxin | Antitoxin |
NKT35_RS11780 (NKT35_11780) | 2566549..2567295 | - | 747 | WP_254293125.1 | plasmid recombination protein | - |
NKT35_RS11785 (NKT35_11785) | 2567399..2568112 | - | 714 | WP_254293127.1 | phage antirepressor N-terminal domain-containing protein | - |
NKT35_RS11790 (NKT35_11790) | 2568109..2568417 | - | 309 | WP_254293129.1 | helix-turn-helix domain-containing protein | - |
NKT35_RS11795 (NKT35_11795) | 2568429..2568650 | - | 222 | WP_254293131.1 | AlpA family phage regulatory protein | - |
NKT35_RS11800 (NKT35_11800) | 2568733..2569386 | - | 654 | WP_254293132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2559007..2569386 | 10379 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10437.90 Da Isoelectric Point: 5.8219
>T250259 WP_256493448.1 NZ_CP100128:2564752-2565030 [Chromobacterium sp. IIBBL 290-4]
MIRSFRCIDTQALFAGESVPSLANIRAVAERKLQMIASACTVGFLRSPPGNRLEALKGDREGQFSIRINDQWRICFRFED
GDAFDVEIVDYH
MIRSFRCIDTQALFAGESVPSLANIRAVAERKLQMIASACTVGFLRSPPGNRLEALKGDREGQFSIRINDQWRICFRFED
GDAFDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|