Detailed information of TA system TA250252

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 138186..138612
• Replicon: plasmid pGZKP13-1
• Accession: NZ_CP100121
• Organism: Klebsiella pneumoniae strain GZKP13

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIK98_RS27410
• Protein ID: WP_001372321.1
• Coordinates: 138186..138311 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	138388..138612 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIK98_RS27375 (133209)	133209..133436	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
NIK98_RS27380 (133573)	133573..134244	-	672	WP_234283413.1	conjugal transfer transcriptional regulator TraJ	-
NIK98_RS27385 (134438)	134438..134821	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIK98_RS27390 (135156)	135156..135746	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
NIK98_RS27395 (136043)	136043..136864	-	822	WP_001234445.1	DUF932 domain-containing protein	-
NIK98_RS27400 (136975)	136975..137271	-	297	WP_001272251.1	hypothetical protein	-
NIK98_RS27405 (137571)	137571..137867	+	297	Protein_162	hypothetical protein	-
NIK98_RS27410 (138186)	138186..138311	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIK98_RS27415 (138253)	138253..138402	-	150	Protein_164	plasmid maintenance protein Mok	-
- (138388)	138388..138612	-	225	NuclAT_0	-	Antitoxin
- (138388)	138388..138612	-	225	NuclAT_0	-	Antitoxin
- (138388)	138388..138612	-	225	NuclAT_0	-	Antitoxin
- (138388)	138388..138612	-	225	NuclAT_0	-	Antitoxin
NIK98_RS27420 (138624)	138624..139343	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
NIK98_RS27425 (139340)	139340..139774	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NIK98_RS27430 (139843)	139843..141866	-	2024	Protein_167	ParB/RepB/Spo0J family partition protein	-
NIK98_RS27435 (141927)	141927..142160	-	234	WP_000006003.1	DUF905 family protein	-
NIK98_RS27440 (142218)	142218..142745	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
NIK98_RS27445 (143047)	143047..143502	+	456	Protein_170	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / aph(6)-Id / aph(3'')-Ib / catA1 / aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 / sitABCD	iutA / iucD / iucC / iucB / iucA	1..185954	185954

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T250252 WP_001372321.1 NZ_CP100121:c138311-138186 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT250252 NZ_CP100121:c138612-138388 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin