Detailed information of TA system TA250229

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 56592..57018
• Replicon: plasmid pHSKP1-2
• Accession: NZ_CP100116
• Organism: Klebsiella pneumoniae strain HSKP1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIL09_RS27220
• Protein ID: WP_001372321.1
• Coordinates: 56592..56717 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	56794..57018 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIL09_RS27185 (51615)	51615..51842	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
NIL09_RS27190 (51979)	51979..52650	-	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
NIL09_RS27195 (52844)	52844..53227	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIL09_RS27200 (53562)	53562..54152	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
NIL09_RS27205 (54449)	54449..55270	-	822	WP_001234445.1	DUF932 domain-containing protein	-
NIL09_RS27210 (55381)	55381..55677	-	297	WP_001272251.1	hypothetical protein	-
NIL09_RS27215 (55977)	55977..56273	+	297	Protein_71	hypothetical protein	-
NIL09_RS27220 (56592)	56592..56717	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIL09_RS27225 (56659)	56659..56808	-	150	Protein_73	plasmid maintenance protein Mok	-
- (56794)	56794..57018	-	225	NuclAT_0	-	Antitoxin
- (56794)	56794..57018	-	225	NuclAT_0	-	Antitoxin
- (56794)	56794..57018	-	225	NuclAT_0	-	Antitoxin
- (56794)	56794..57018	-	225	NuclAT_0	-	Antitoxin
NIL09_RS27230 (57030)	57030..57749	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
NIL09_RS27235 (57746)	57746..58180	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NIL09_RS27240 (58249)	58249..60272	-	2024	Protein_76	ParB/RepB/Spo0J family partition protein	-
NIL09_RS27245 (60333)	60333..60566	-	234	WP_000006003.1	DUF905 family protein	-
NIL09_RS27250 (60624)	60624..61151	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
NIL09_RS27255 (61453)	61453..61914	+	462	Protein_79	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	ant(3'')-Ia / qacE / cmlA1 / sitABCD	iutA / iucD / iucC / iucB / iucA	1..110202	110202

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T250229 WP_001372321.1 NZ_CP100116:c56717-56592 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT250229 NZ_CP100116:c57018-56794 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin