Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 77070..77323 | Replicon | plasmid pHSKP1-1 |
| Accession | NZ_CP100115 | ||
| Organism | Klebsiella pneumoniae strain HSKP1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NIL09_RS26380 | Protein ID | WP_001312851.1 |
| Coordinates | 77070..77219 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 77264..77323 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL09_RS26350 (73093) | 73093..73494 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NIL09_RS26355 (73427) | 73427..73684 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NIL09_RS26360 (73777) | 73777..74430 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NIL09_RS26365 (75369) | 75369..76226 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NIL09_RS26370 (76245) | 76245..76423 | - | 179 | Protein_102 | protein CopA/IncA | - |
| NIL09_RS26375 (76538) | 76538..76786 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NIL09_RS26380 (77070) | 77070..77219 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (77264) | 77264..77323 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (77264) | 77264..77323 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (77264) | 77264..77323 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (77264) | 77264..77323 | + | 60 | NuclAT_1 | - | Antitoxin |
| NIL09_RS26385 (77524) | 77524..77856 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| NIL09_RS26390 (77918) | 77918..78517 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NIL09_RS26395 (78903) | 78903..79103 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| NIL09_RS26400 (79235) | 79235..79795 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NIL09_RS26405 (79850) | 79850..80596 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NIL09_RS26410 (80616) | 80616..80816 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| NIL09_RS26415 (80841) | 80841..81545 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NIL09_RS26420 (81598) | 81598..81663 | + | 66 | Protein_112 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / sul1 / qacE / aadA2 / dfrA12 / catA2 | - | 1..142065 | 142065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T250224 WP_001312851.1 NZ_CP100115:c77219-77070 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT250224 NZ_CP100115:77264-77323 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
