Detailed information of TA system TA250222

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 34353..34622
• Replicon: plasmid pHSKP1-1
• Accession: NZ_CP100115
• Organism: Klebsiella pneumoniae strain HSKP1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIL09_RS26090
• Protein ID: WP_001372321.1
• Coordinates: 34497..34622 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	34353..34418 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIL09_RS26060	30063..30590	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NIL09_RS26065	30648..30881	+	234	WP_000006003.1	DUF905 family protein	-
NIL09_RS26070	30942..32965	+	2024	Protein_42	ParB/RepB/Spo0J family partition protein	-
NIL09_RS26075	33034..33468	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NIL09_RS26080	33465..34184	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	34196..34420	+	225	NuclAT_0	-	-
-	34196..34420	+	225	NuclAT_0	-	-
-	34196..34420	+	225	NuclAT_0	-	-
-	34196..34420	+	225	NuclAT_0	-	-
-	34353..34418	-	66	-	-	Antitoxin
NIL09_RS26085	34406..34555	+	150	Protein_45	plasmid maintenance protein Mok	-
NIL09_RS26090	34497..34622	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIL09_RS26095	34941..35237	-	297	Protein_47	hypothetical protein	-
NIL09_RS26100	35537..35833	+	297	WP_001272251.1	hypothetical protein	-
NIL09_RS26105	35944..36765	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NIL09_RS26110	37062..37709	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NIL09_RS26115	37986..38369	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIL09_RS26120	38560..39246	+	687	WP_015059009.1	PAS domain-containing protein	-
NIL09_RS26125	39340..39567	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / sul1 / qacE / aadA2 / dfrA12 / catA2	-	1..142065	142065

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T250222 WP_001372321.1 NZ_CP100115:34497-34622 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT250222 NZ_CP100115:c34418-34353 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin